Product Number |
ARP60149_P050-FITC |
Product Page |
www.avivasysbio.com/cyp26a1-antibody-n-terminal-region-fitc-arp60149-p050-fitc.html |
Name |
CYP26A1 Antibody - N-terminal region : FITC (ARP60149_P050-FITC) |
Protein Size (# AA) |
497 amino acids |
Molecular Weight |
54kDa |
Conjugation |
FITC: Fluorescein Isothiocyanate |
NCBI Gene Id |
1592 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Alias Symbols |
CP26, CYP26, P450RAI, P450RAI1 |
Peptide Sequence |
Synthetic peptide located within the following region: HRLVSVHWPASVRTILGSGCLSNLHDSSHKQRKKVIMRAFSREALECYVP |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer. |
Description of Target |
This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This endoplasmic reticulum protein acts on retinoids, including all-trans-retinoic acid (RA), with both 4-hydroxylation and 18-hydroxylation activities. This enzyme regulates the cellular level of retinoic acid which is involved in regulation of gene expression in both embryonic and adult tissues. Two alternatively spliced transcript variants of this gene, which encode the distinct isoforms, have been reported. |
Reconstitution and Storage |
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
Datasheets/Manuals |
Printable datasheet for anti-CYP26A1 (ARP60149_P050-FITC) antibody |
Blocking Peptide |
For anti-CYP26A1 (ARP60149_P050-FITC) antibody is Catalog # AAP60149 |
Immunogen |
The immunogen is a synthetic peptide directed towards the N-terminal region of Human CYP26A1 |
Uniprot ID |
O43174 |
Purification |
Affinity Purified |
Gene Symbol |
CYP26A1 |
Predicted Species Reactivity |
Human |
Application |
WB |
Image 1 | |
|