Catalog No: ARP60144_P050-HRP
Size:100ul
Price: $434.00
SKU
ARP60144_P050-HRP
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.

CYP21A2 Antibody - C-terminal region : HRP (ARP60144_P050-HRP)

Datasheets/ManualsPrintable datasheet for anti-CYP21A2 (ARP60144_P050-HRP) antibody
Product Info
Predicted Species ReactivityHuman, Cow, Dog, Guinea Pig, Pig, Sheep
Product FormatLiquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
ClonalityPolyclonal
HostRabbit
ConjugationHRP: Horseradish Peroxidase
ApplicationIHC, WB
Reconstitution and StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
ImmunogenThe immunogen is a synthetic peptide directed towards the C terminal region of human CYP21A2
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 92%; Dog: 92%; Guinea Pig: 80%; Human: 100%; Pig: 92%; Sheep: 92%
Peptide SequenceSynthetic peptide located within the following region: IQQRLQEELDHELGPGASSSRVPYKDRARLPLLNATIAEVLRLRPVVPLA
Concentration0.5 mg/ml
Blocking PeptideFor anti-CYP21A2 (ARP60144_P050-HRP) antibody is Catalog # AAP60144 (Previous Catalog # AAPP46278)
Gene SymbolCYP21A2
Gene Full NameCytochrome P450, family 21, subfamily A, polypeptide 2
Alias SymbolsCAH1, CPS1, CA21H, CYP21, CYP21B, P450c21B
NCBI Gene Id1589
Protein NameCytochrome P450 21-hydroxylase EMBL AAB67982.1
Description of TargetThis gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum and hydroxylates steroids at the 21 position. Its activity is required for the synthesis of steroid hormones including cortisol and aldosterone. Mutations in this gene cause congenital adrenal hyperplasia. A related pseudogene is located near this gene; gene conversion events involving the functional gene and the pseudogene are thought to account for many cases of steroid 21-hydroxylase deficiency. Two transcript variants encoding different isoforms have been found for this gene.
Uniprot IDQ16874
Protein Accession #NP_000491
Nucleotide Accession #NM_000500
Protein Size (# AA)495
Molecular Weight56kDa
  1. What is the species homology for "CYP21A2 Antibody - C-terminal region : HRP (ARP60144_P050-HRP)"?

    The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human, Cow, Dog, Guinea Pig, Pig, Sheep".

  2. How long will it take to receive "CYP21A2 Antibody - C-terminal region : HRP (ARP60144_P050-HRP)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "CYP21A2 Antibody - C-terminal region : HRP (ARP60144_P050-HRP)" provided in?

    This item is provided in "Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "CYP21A2 Antibody - C-terminal region : HRP (ARP60144_P050-HRP)"?

    This target may also be called "CAH1, CPS1, CA21H, CYP21, CYP21B, P450c21B" in publications.

  5. What is the shipping cost for "CYP21A2 Antibody - C-terminal region : HRP (ARP60144_P050-HRP)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "CYP21A2 Antibody - C-terminal region : HRP (ARP60144_P050-HRP)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "CYP21A2 Antibody - C-terminal region : HRP (ARP60144_P050-HRP)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "56kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "CYP21A2 Antibody - C-terminal region : HRP (ARP60144_P050-HRP)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "CYP21A2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "CYP21A2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "CYP21A2"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "CYP21A2"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "CYP21A2"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "CYP21A2"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:CYP21A2 Antibody - C-terminal region : HRP (ARP60144_P050-HRP)
Your Rating
We found other products you might like!