Search Antibody, Protein, and ELISA Kit Solutions

CYP11B2 antibody - middle region (ARP41750_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP41750_P050-FITC Conjugated

ARP41750_P050-HRP Conjugated

ARP41750_P050-Biotin Conjugated

Gene Symbol:
NCBI Gene Id:
Official Gene Full Name:
Cytochrome P450, family 11, subfamily B, polypeptide 2
Protein Name:
Cytochrome P450 11B2, mitochondrial
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
ALDOS, CPN2, CYP11B, CYP11BL, P-450C18, P450C18, P450aldo
Replacement Item:
This antibody may replace item sc-32372 from Santa Cruz Biotechnology.
Description of Target:
This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein local
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express CYP11B2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express CYP11B2.
The immunogen is a synthetic peptide directed towards the middle region of human CYP11B2
Tested Species Reactivity:
Predicted Homology Based on Immunogen Sequence:
Horse: 79%; Human: 100%
Complete computational species homology data:
Anti-CYP11B2 (ARP41750_P050)
Peptide Sequence:
Synthetic peptide located within the following region: RRLAEAEMLLLLHHVLKHFLVETLTQEDIKMVYSFILRPGTSPLLTFRAI
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
CYP11B2; CYP11B1; CYP11A1; FDX1;
Blocking Peptide:
For anti-CYP11B2 (ARP41750_P050) antibody is Catalog # AAP41750 (Previous Catalog # AAPP24392)
Printable datasheet for anti-CYP11B2 (ARP41750_P050) antibody
Target Reference:
Brenner,D., (er) J. Neurol. (2008) In press

Doi, M. et al. Isoform-specific monoclonal antibodies against 3β-hydroxysteroid dehydrogenase/isomerase family provide markers for subclassification of human primary aldosteronism. J. Clin. Endocrinol. Metab. 99, E257-62 (2014). WB, Horse, Human 24423300

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...