Size:100 ul
Special Price $229.00 Regular Price $289.00
In stock
SKU
ARP41750_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP41750_P050-FITC Conjugated

ARP41750_P050-HRP Conjugated

ARP41750_P050-Biotin Conjugated

CYP11B2 Antibody - middle region (ARP41750_P050)

Catalog#: ARP41750_P050
Domestic: within 1-2 days delivery International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Horse, Human
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-32372 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human CYP11B2
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Horse: 79%; Human: 100%
Complete computational species homology data Anti-CYP11B2 (ARP41750_P050)
Peptide Sequence Synthetic peptide located within the following region: RRLAEAEMLLLLHHVLKHFLVETLTQEDIKMVYSFILRPGTSPLLTFRAI
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-CYP11B2 (ARP41750_P050) antibody is Catalog # AAP41750 (Previous Catalog # AAPP24392)
Datasheets/Manuals Printable datasheet for anti-CYP11B2 (ARP41750_P050) antibody
Target Reference Brenner,D., (er) J. Neurol. (2008) In press
Publications

Doi, M. et al. Isoform-specific monoclonal antibodies against 3b-hydroxysteroid dehydrogenase/isomerase family provide markers for subclassification of human primary aldosteronism. J. Clin. Endocrinol. Metab. 99, E257-62 (2014). WB, Horse, Human 24423300

Gene Symbol CYP11B2
Official Gene Full Name Cytochrome P450, family 11, subfamily B, polypeptide 2
Alias Symbols ALDOS, CPN2, CYP11B, CYP11BL, P-450C18, P450C18, P450aldo
NCBI Gene Id 1585
Protein Name Cytochrome P450 11B2, mitochondrial
Description of Target This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein local
Swissprot Id P19099
Protein Accession # NP_000489
Nucleotide Accession # NM_000498
Protein Size (# AA) 503
Molecular Weight 55kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express CYP11B2.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express CYP11B2.
Protein Interactions CYP11B2; CYP11B1; CYP11A1; FDX1;
Write Your Own Review
You're reviewing:CYP11B2 Antibody - middle region (ARP41750_P050)
Your Rating