| Product Number |
ARP41750_P050 |
| Product Page |
www.avivasysbio.com/cyp11b2-antibody-middle-region-arp41750-p050.html |
| Name |
CYP11B2 Antibody - middle region (ARP41750_P050) |
| Protein Size (# AA) |
503 amino acids |
| Molecular Weight |
55kDa |
| NCBI Gene Id |
1585 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Cytochrome P450, family 11, subfamily B, polypeptide 2 |
| Alias Symbols |
CPN2, ALDOS, CYP11B, CYP11BL, CYPXIB2, P450C18, P-450C18, P450aldo |
| Peptide Sequence |
Synthetic peptide located within the following region: RRLAEAEMLLLLHHVLKHFLVETLTQEDIKMVYSFILRPGTSPLLTFRAI |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Brenner,D., (er) J. Neurol. (2008) In press |
| Description of Target |
This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein local |
| Protein Interactions |
CYP11B2; CYP11B1; CYP11A1; FDX1; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-CYP11B2 (ARP41750_P050) antibody |
| Blocking Peptide |
For anti-CYP11B2 (ARP41750_P050) antibody is Catalog # AAP41750 (Previous Catalog # AAPP24392) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human CYP11B2 |
| Uniprot ID |
P19099 |
| Protein Name |
Cytochrome P450 11B2, mitochondrial |
| Publications |
Doi, M. et al. Isoform-specific monoclonal antibodies against 3beta-hydroxysteroid dehydrogenase/isomerase family provide markers for subclassification of human primary aldosteronism. J. Clin. Endocrinol. Metab. 99, E257-62 (2014). 24423300 |
| Protein Accession # |
NP_000489 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_000498 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
CYP11B2 |
| Predicted Species Reactivity |
Human, Horse |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Horse: 79%; Human: 100% |
| Image 1 | Human OVCAR3
 | WB Suggested Anti-CYP11B2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: OVCAR-3 cell lysate |
|
| Image 2 | transfected HEK293-CYP11B2
 | Sample type: 1. HEK293TN-GFP-hcyp11B1 (75ug)
2. HEK293TN-GFP-hcyp11B2 (75ug)
Primary dilution: 1:100
Secondary Antibody: mouse anti-Rabbit HRP
Secondary Dilution: 1:10,000
Film Exposed for: 15 minutes
Image Submitted by: Celso Gomez-Sanchez
Mongomery VA Medical Center |
|
