Search Antibody, Protein, and ELISA Kit Solutions

CTSE Antibody - N-terminal region (ARP60124_P050)

100 ul

Regular Price: $289.00

Special Price: $229.00

In Stock
Request Bulk Order Quote

Conjugation Options

ARP60124_P050-FITC Conjugated

ARP60124_P050-HRP Conjugated

ARP60124_P050-Biotin Conjugated

Tested Species Reactivity:
Human
Predicted Species Reactivity:
Horse, Human
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality:
Polyclonal
Host:
Rabbit
Application:
WB
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item:
This antibody may replace item sc-166285 from Santa Cruz Biotechnology.
Purification:
Affinity Purified
Predicted Homology Based on Immunogen Sequence:
Horse: 79%; Human: 100%
Complete computational species homology data:
Anti-CTSE (ARP60124_P050)
Peptide Sequence:
Synthetic peptide located within the following region: SLKKKLRARSQLSEFWKSHNLDMIQFTESCSMDQSAKEPLINYLDMEYFG
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-CTSE (ARP60124_P050) antibody is Catalog # AAP60124
Datasheets/Manuals:
Printable datasheet for anti-CTSE (ARP60124_P050) antibody
Gene Symbol:
CTSE
Official Gene Full Name:
Cathepsin E
Alias Symbols:
CATE
NCBI Gene Id:
1510
Protein Name:
Cathepsin E
Description of Target:
The protein encoded by this gene is a gastric aspartyl protease that functions as a disulfide-linked homodimer. This protease, which is a member of the peptidase C1 family, has a specificity similar to that of pepsin A and cathepsin D. It is an intracellular proteinase that does not appear to be involved in the digestion of dietary protein and is found in highest concentration in the surface of epithelial mucus-producing cells of the stomach. It is the first aspartic proteinase expressed in the fetal stomach and is found in more than half of gastric cancers. It appears, therefore, to be an oncofetal antigen. Transcript variants utilizing alternative polyadenylation signals and two transcript variants encoding different isoforms exist for this gene.
Swissprot Id:
P14091
Protein Accession #:
NP_683865
Nucleotide Accession #:
NM_148964
Protein Size (# AA):
363
Molecular Weight:
40kDa
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express CTSE.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express CTSE.
Protein Interactions:
EMG1; INS; BAG6; EDN3; CTSE; A2M;

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...