| Product Number |
ARP60124_P050 |
| Product Page |
www.avivasysbio.com/ctse-antibody-n-terminal-region-arp60124-p050.html |
| Name |
CTSE Antibody - N-terminal region (ARP60124_P050) |
| Protein Size (# AA) |
363 amino acids |
| Molecular Weight |
40kDa |
| NCBI Gene Id |
1510 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Cathepsin E |
| Alias Symbols |
CATE |
| Peptide Sequence |
Synthetic peptide located within the following region: SLKKKLRARSQLSEFWKSHNLDMIQFTESCSMDQSAKEPLINYLDMEYFG |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
The protein encoded by this gene is a gastric aspartyl protease that functions as a disulfide-linked homodimer. This protease, which is a member of the peptidase C1 family, has a specificity similar to that of pepsin A and cathepsin D. It is an intracellular proteinase that does not appear to be involved in the digestion of dietary protein and is found in highest concentration in the surface of epithelial mucus-producing cells of the stomach. It is the first aspartic proteinase expressed in the fetal stomach and is found in more than half of gastric cancers. It appears, therefore, to be an oncofetal antigen. Transcript variants utilizing alternative polyadenylation signals and two transcript variants encoding different isoforms exist for this gene. |
| Protein Interactions |
EMG1; INS; BAG6; EDN3; CTSE; A2M; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-CTSE (ARP60124_P050) antibody |
| Blocking Peptide |
For anti-CTSE (ARP60124_P050) antibody is Catalog # AAP60124 |
| Uniprot ID |
P14091 |
| Protein Name |
Cathepsin E |
| Protein Accession # |
NP_683865 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_148964 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
CTSE |
| Predicted Species Reactivity |
Human, Horse |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Horse: 79%; Human: 100% |
| Image 1 | Human NCI-H226
 | WB Suggested Anti-CTSE Antibody
Titration: 1.0 ug/ml
Positive Control: NCI-H226 Whole Cell |
|
|
