Size:100 ul
Special Price $229.00 Regular Price $289.00
In Stock
Request Bulk
Order Quote
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email:
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP53533_P050-FITC Conjugated

ARP53533_P050-HRP Conjugated

ARP53533_P050-Biotin Conjugated

Cst6 Antibody - middle region (ARP53533_P050)

Catalog#: ARP53533_P050
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species Reactivity Mouse
Predicted Species Reactivity Cow, Guinea Pig, Human, Mouse, Rabbit, Rat
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-368674 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human Cst6
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 79%; Guinea Pig: 86%; Human: 100%; Mouse: 79%; Rabbit: 86%; Rat: 93%
Complete computational species homology data Anti-Cst6 (ARP53533_P050)
Peptide Sequence Synthetic peptide located within the following region: CGELIPPPPPSYRLSLTLTSPLSTAAKELVLIPLHAAPNQAVAEIDALYD
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-Cst6 (ARP53533_P050) antibody is Catalog # AAP53533 (Previous Catalog # AAPP32074)
Datasheets/Manuals Printable datasheet for anti-Cst6 (ARP53533_P050) antibody

Füllgrabe, A; Joost, S; Are, A; Jacob, T; Sivan, U; Haegebarth, A; Linnarsson, S; Simons, BD; Clevers, H; Toftgård, R; Kasper, M; Dynamics of Lgr6⁺ Progenitor Cells in the Hair Follicle, Sebaceous Gland, and Interfollicular Epidermis. 5, 843-55 (2015). WB, Cow, Guinea Pig, Human, Mouse, Rabbit, Rat 26607954

Veniaminova, N. A. et al. Keratin 79 identifies a novel population of migratory epithelial cells that initiates hair canal morphogenesis and regeneration. Development 140, 4870-80 (2013). WB, Cow, Guinea Pig, Human, Mouse, Rabbit, Rat 24198274

Gene Symbol Cst6
Official Gene Full Name Cystatin E/M
Alias Symbols 1110017E11Rik, N28197, ichq
NCBI Gene Id 73720
Protein Name Cystatin E/M EMBL AAH61036.1
Description of Target The function of Cst6 remains unknown.
Swissprot Id Q9D1B1
Protein Accession # NP_082899
Nucleotide Accession # NM_028623
Protein Size (# AA) 149
Molecular Weight 16kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express Cst6.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express Cst6.
  1. What is the species homology for "Cst6 Antibody - middle region (ARP53533_P050)"?

    The tested species reactivity for this item is "Mouse". This antibody is predicted to have homology to "Cow, Guinea Pig, Human, Mouse, Rabbit, Rat".

  2. How long will it take to receive "Cst6 Antibody - middle region (ARP53533_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "Cst6 Antibody - middle region (ARP53533_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact

  4. What are other names for "Cst6 Antibody - middle region (ARP53533_P050)"?

    This target may also be called "1110017E11Rik, N28197, ichq" in publications.

  5. What is the shipping cost for "Cst6 Antibody - middle region (ARP53533_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "Cst6 Antibody - middle region (ARP53533_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "Cst6 Antibody - middle region (ARP53533_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "16kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "Cst6 Antibody - middle region (ARP53533_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "CST6"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "CST6"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "CST6"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "CST6"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "CST6"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "CST6"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:Cst6 Antibody - middle region (ARP53533_P050)
Your Rating