Size:100 ul
Special Price $229.00 Regular Price $289.00
In stock
SKU
ARP53533_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP53533_P050-FITC Conjugated

ARP53533_P050-HRP Conjugated

ARP53533_P050-Biotin Conjugated

Cst6 Antibody - middle region (ARP53533_P050)

Catalog#: ARP53533_P050
Domestic: within 1-2 days delivery International: 1-2 days
More Information
Tested Species Reactivity Mouse
Predicted Species Reactivity Cow, Guinea Pig, Human, Mouse, Rabbit, Rat
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-368674 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human Cst6
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 79%; Guinea Pig: 86%; Human: 100%; Mouse: 79%; Rabbit: 86%; Rat: 93%
Complete computational species homology data Anti-Cst6 (ARP53533_P050)
Peptide Sequence Synthetic peptide located within the following region: CGELIPPPPPSYRLSLTLTSPLSTAAKELVLIPLHAAPNQAVAEIDALYD
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-Cst6 (ARP53533_P050) antibody is Catalog # AAP53533 (Previous Catalog # AAPP32074)
Datasheets/Manuals Printable datasheet for anti-Cst6 (ARP53533_P050) antibody
Publications

Füllgrabe, A; Joost, S; Are, A; Jacob, T; Sivan, U; Haegebarth, A; Linnarsson, S; Simons, BD; Clevers, H; Toftgård, R; Kasper, M; Dynamics of Lgr6⁺ Progenitor Cells in the Hair Follicle, Sebaceous Gland, and Interfollicular Epidermis. 5, 843-55 (2015). WB, Cow, Guinea Pig, Human, Mouse, Rabbit, Rat 26607954

Veniaminova, N. A. et al. Keratin 79 identifies a novel population of migratory epithelial cells that initiates hair canal morphogenesis and regeneration. Development 140, 4870-80 (2013). WB, Cow, Guinea Pig, Human, Mouse, Rabbit, Rat 24198274

Gene Symbol Cst6
Official Gene Full Name Cystatin E/M
Alias Symbols 1110017E11Rik, N28197, ichq
NCBI Gene Id 73720
Protein Name Cystatin E/M EMBL AAH61036.1
Description of Target The function of Cst6 remains unknown.
Swissprot Id Q9D1B1
Protein Accession # NP_082899
Nucleotide Accession # NM_028623
Protein Size (# AA) 149
Molecular Weight 16kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express Cst6.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express Cst6.
Write Your Own Review
You're reviewing:Cst6 Antibody - middle region (ARP53533_P050)
Your Rating