Search Antibody, Protein, and ELISA Kit Solutions

Cst6 Antibody - middle region (ARP53533_P050)

100 ul

Regular Price: $289.00

Special Price: $229.00

In Stock
Request Bulk Order Quote

Conjugation Options

ARP53533_P050-FITC Conjugated

ARP53533_P050-HRP Conjugated

ARP53533_P050-Biotin Conjugated

Tested Species Reactivity:
Predicted Species Reactivity:
Cow, Guinea Pig, Human, Mouse, Rabbit, Rat
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item:
This antibody may replace item sc-368674 from Santa Cruz Biotechnology.
The immunogen is a synthetic peptide directed towards the middle region of human Cst6
Affinity Purified
Predicted Homology Based on Immunogen Sequence:
Cow: 79%; Guinea Pig: 86%; Human: 100%; Mouse: 79%; Rabbit: 86%; Rat: 93%
Complete computational species homology data:
Anti-Cst6 (ARP53533_P050)
Peptide Sequence:
Synthetic peptide located within the following region: CGELIPPPPPSYRLSLTLTSPLSTAAKELVLIPLHAAPNQAVAEIDALYD
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-Cst6 (ARP53533_P050) antibody is Catalog # AAP53533 (Previous Catalog # AAPP32074)
Printable datasheet for anti-Cst6 (ARP53533_P050) antibody

Füllgrabe, A; Joost, S; Are, A; Jacob, T; Sivan, U; Haegebarth, A; Linnarsson, S; Simons, BD; Clevers, H; Toftgård, R; Kasper, M; Dynamics of Lgr6⁺ Progenitor Cells in the Hair Follicle, Sebaceous Gland, and Interfollicular Epidermis. 5, 843-55 (2015). WB, Cow, Guinea Pig, Human, Mouse, Rabbit, Rat 26607954

Veniaminova, N. A. et al. Keratin 79 identifies a novel population of migratory epithelial cells that initiates hair canal morphogenesis and regeneration. Development 140, 4870-80 (2013). WB, Cow, Guinea Pig, Human, Mouse, Rabbit, Rat 24198274

Gene Symbol:
Official Gene Full Name:
Cystatin E/M
Alias Symbols:
1110017E11Rik, N28197, ichq
NCBI Gene Id:
Protein Name:
Cystatin E/M EMBL AAH61036.1
Description of Target:
The function of Cst6 remains unknown.
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Protein Size (# AA):
Molecular Weight:
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express Cst6.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express Cst6.

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...