| Product Number |
ARP53533_P050 |
| Product Page |
www.avivasysbio.com/cst6-antibody-middle-region-arp53533-p050.html |
| Name |
Cst6 Antibody - middle region (ARP53533_P050) |
| Protein Size (# AA) |
149 amino acids |
| Molecular Weight |
16kDa |
| NCBI Gene Id |
73720 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Cystatin E/M |
| Alias Symbols |
ichq, N28197, 1110017E11Rik |
| Peptide Sequence |
Synthetic peptide located within the following region: CGELIPPPPPSYRLSLTLTSPLSTAAKELVLIPLHAAPNQAVAEIDALYD |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
The function of Cst6 remains unknown. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-Cst6 (ARP53533_P050) antibody |
| Blocking Peptide |
For anti-Cst6 (ARP53533_P050) antibody is Catalog # AAP53533 (Previous Catalog # AAPP32074) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human Cst6 |
| Uniprot ID |
Q9D1B1 |
| Protein Name |
Cystatin E/M EMBL AAH61036.1 |
| Publications |
Dynamics of Lgr6⺠Progenitor Cells in the Hair Follicle, Sebaceous Gland, and Interfollicular Epidermis. Stem Cell Reports. 5, 843-55 (2015). 26607954
Veniaminova, N. A. et al. Keratin 79 identifies a novel population of migratory epithelial cells that initiates hair canal morphogenesis and regeneration. Development 140, 4870-80 (2013). 24198274 |
| Protein Accession # |
NP_082899 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_028623 |
| Tested Species Reactivity |
Mouse |
| Gene Symbol |
Cst6 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Guinea Pig, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 79%; Guinea Pig: 86%; Human: 100%; Mouse: 79%; Rabbit: 86%; Rat: 93% |
| Image 1 | Mouse Spleen
 | WB Suggested Anti-Cst6 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Mouse Spleen |
|
|
