CROT Antibody - middle region (ARP81800_P050)

Catalog No: ARP81800_P050

Host: Rabbit
Target Name: CROT
Sample Tissue: Human HepG2 Whole Cell lysates
Antibody Dilution: 1ug/ml

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CROT
• Purification: Affinity purified
• Peptide Sequence: Synthetic peptide located within the following region: VHKVGNTPLDMNQFRMLFSTCKVPGITRDSIMNYFRTESEGRSPNHIVVL
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-CROT (ARP81800_P050) antibody is Catalog # AAP81800

Target Info

• Gene Symbol: CROT
• Gene Full Name: carnitine O-octanoyltransferase
• Alias Symbols: COT
• NCBI Gene Id: 54677
• Protein Name: peroxisomal carnitine O-octanoyltransferase
• Description of Target: This gene encodes a member of the carnitine/choline acetyltransferase family. The encoded protein converts 4,8-dimethylnonanoyl-CoA to its corresponding carnitine ester. This transesterification occurs in the peroxisome and is necessary for transport of medium- and long- chain acyl-CoA molecules out of the peroxisome to the cytosol and mitochondria. The protein thus plays a role in lipid metabolism and fatty acid beta-oxidation. Alternatively spliced transcript variants have been described.
• Uniprot ID: Q9UKG9
• Protein Accession #: NP_001137407.1
• Nucleotide Accession #: NM_001143935.1
• Protein Size (# AA): 612
• Molecular Weight: 67 kDa