CROT Antibody - N-terminal region (ARP48873_T100)

Catalog No: ARP48873_T100

WB Suggested Anti-CROT Antibody Titration: 2.5ug/ml
Positive Control: HepG2 cell lysate

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit, Yeast, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human CROT
• Purification: Protein A purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Yeast: 90%; Zebrafish: 86%
• Peptide Sequence: Synthetic peptide located within the following region: MENQLAKSTEERTFQYQDSLPSLPVPSLEESLKKYLESVKPFANQEEYKK
• Concentration: 1.0 mg/ml
• Blocking Peptide: For anti-CROT (ARP48873_T100) antibody is Catalog # AAP48873 (Previous Catalog # AAPP28926)
• Reference: Morillas,M., (2002) J. Biol. Chem. 277 (13), 11473-11480

Target Info

• Gene Symbol: CROT
• Gene Full Name: Carnitine O-octanoyltransferase
• Alias Symbols: COT
• NCBI Gene Id: 54677
• Protein Name: Peroxisomal carnitine O-octanoyltransferase
• Description of Target: Carnitine octanoyltransferase is a carnitine acyltransferase that catalyzes the reversible transfer of fatty acyl groups between CoA and carnitine. This provides a crucial step in the transport of medium- and long-chain acyl-CoA out of the mammalian peroxisome to the cytosol and mitochondria.Carnitine octanoyltransferase (EC 2.3.1.137) is a carnitine acyltransferase that catalyzes the reversible transfer of fatty acyl groups between CoA and carnitine. This provides a crucial step in the transport of medium- and long-chain acyl-CoA out of the mammalian peroxisome to the cytosol and mitochondria. See also CRAT (MIM 600184). Van der Leij et al. (2000) [PubMed 11001805] reviewed the function, structural features, and phylogenetics of human carnitine acyltransferase genes, including CROT.[supplied by OMIM].
• Uniprot ID: Q9UKG9
• Protein Accession #: NP_066974
• Nucleotide Accession #: NM_021151
• Protein Size (# AA): 612
• Molecular Weight: 70kDa
• Protein Interactions: UBC; ALB; PEX5; DSTN;