COX16 Antibody - middle region (ARP94377_P050)

Catalog No: ARP94377_P050

Host: Rabbit
Target Name: DISP2
Sample Tissue: Mouse Lung lysates
Antibody Dilution: 1ug/ml

Product Info

• Tested Species Reactivity: Mouse
• Predicted Species Reactivity: Mouse
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of mouse DISP2
• Purification: Affinity purified
• Peptide Sequence: Synthetic peptide located within the following region: RDTLWLALKETIYDPNMPNSHHSSLSWKGRGGPGDISPVMLPNSQPDLPD
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-DISP2 (ARP94377_P050) antibody is Catalog # AAP94377

Target Info

• Gene Symbol: DISP2
• Gene Full Name: dispatched RND tramsporter family member 2
• Alias Symbols: Di, DispB, AI840597, mKIAA1742, B230210L08Rik
• NCBI Gene Id: 214240
• Protein Name: protein dispatched homolog 2
• Description of Target: The pattern of cellular proliferation and differentiation that leads to normal development of embryonic structures often depends upon the localized production of secreted protein signals. Cells surrounding the source of a particular signal respond in a graded manner according to the effective concentration of the signal, and this response produces the pattern of cell types constituting the mature structure. A segment-polarity gene known as dispatched has been identified in Drosophila and its protein product is required for normal Hedgehog (Hh) signaling.
• Uniprot ID: Q8CIP5
• Protein Accession #: NP_733481.1
• Nucleotide Accession #: NM_170593.3
• Protein Size (# AA): 1345
• Molecular Weight: 148 kDa