COL6A1 Antibody - middle region (ARP45803_P050)

Catalog No: ARP45803_P050

WB Suggested Anti-COL6A1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:12500
Positive Control: 721_B cell lysateThere is BioGPS gene expression data showing that COL6A1 is expressed in 721_B

WB Suggested Anti-COL6A1 Antibody Titration: 5% Milk
ELISA Titer: dilution: 1:500
Positive Control: human LCL

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human COL6A1
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 93%; Dog: 100%; Horse: 93%; Human: 100%; Mouse: 86%; Pig: 100%; Rabbit: 100%; Rat: 93%
• Peptide Sequence: Synthetic peptide located within the following region: ADITILLDGSASVGSHNFDTTKRFAKRLAERFLTAGRTDPAHDVRVAVVQ
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-COL6A1 (ARP45803_P050) antibody is Catalog # AAP45803 (Previous Catalog # AAPP26746)
• Sample Type Confirmation:

  There is BioGPS gene expression data showing that COL6A1 is expressed in 721_B

• Reference: Hicks,D., (2008) Neurology 70 (14), 1192-1199

Target Info

• Gene Symbol: COL6A1
• Gene Full Name: Collagen, type VI, alpha 1
• Alias Symbols: OPLL, BTHLM1, UCHMD1
• NCBI Gene Id: 1291
• Protein Name: Collagen alpha-1(VI) chain
• Description of Target: COL6A1 is a collagen VI which acts as a cell-binding protein.Defects in COL6A1 are a cause of Bethlem myopathy (BM).The collagens are a superfamily of proteins that play a role in maintaining the integrity of various tissues. Collagens are extracellular matrix proteins and have a triple-helical domain as their common structural element. Collagen VI is a major structural component of microfibrils. The basic structural unit of collagen VI is a heterotrimer of the alpha1(VI), alpha2(VI), and alpha3(VI) chains. The alpha2(VI) and alpha3(VI) chains are encoded by the COL6A2 and COL6A3 genes, respectively. The protein encoded by this gene is the alpha 1 subunit of type VI collagen (alpha1(VI) chain). Mutations in the genes that code for the collagen VI subunits result in the autosomal dominant disorder, Bethlem myopathy. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. This gene, which encodes a neural small non-messenger RNA, is a member of the family of interspersed repetitive DNA, and its product represents an example of a primate tissue-specific RNA polymerase III transcript. The RNA sequence is divided into three domains: a 5' portion homologous to the Alu Lm, a central adenosine-rich region, and the terminal 43-nt nonrepetitive domain. It is believed that this gene was retropositionally generated and recruited into a function regulating dendritic protein biosynthesis. At least two pseudogenes of this gene have been identified. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-200 AF020057.2 4262-4461
• Uniprot ID: P12109
• Protein Accession #: NP_001839
• Nucleotide Accession #: NM_001848
• Protein Size (# AA): 1028
• Molecular Weight: 106kDa
• Protein Interactions: PDGFB; PDGFA; PDIA3; FBXO6; UBC; VHL; DNAJB11; LGALS3BP; LAMB1; FGF7; COL2A1; MAG; DCN;