Catalog No: ARP39026_P050
Price: $0.00
SKU
ARP39026_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-CNOT7 (ARP39026_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit, Yeast, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationIHC, WB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human CNOT7
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 79%; Zebrafish: 100%
Peptide SequenceSynthetic peptide located within the following region: TEFPGVVARPIGEFRSNADYQYQLLRCNVDLLKIIQLGLTFMNEQGEYPP
Concentration0.5 mg/ml
Blocking PeptideFor anti-CNOT7 (ARP39026_P050) antibody is Catalog # AAP39026 (Previous Catalog # AAPS03806)
Sample Type Confirmation

CNOT7 is supported by BioGPS gene expression data to be expressed in HepG2

Subunit7
ReferenceKimura,K., (2006) Genome Res. 16 (1), 55-65
Publications

Maragozidis, P. et al. Alterations of deadenylase expression in acute leukemias: evidence for poly(a)-specific ribonuclease as a potential biomarker. Acta Haematol. 128, 39-46 (2012). 22614729

Gene SymbolCNOT7
Gene Full NameCCR4-NOT transcription complex, subunit 7
Alias SymbolsCAF1, CAF-1, Caf1a, hCAF-1
NCBI Gene Id29883
Protein NameCCR4-NOT transcription complex subunit 7
Description of TargetCNOT7 binds to an anti-proliferative protein, B-cell translocation protein 1, which negatively regulates cell proliferation. Binding of the two proteins, which is driven by phosphorylation of the anti-proliferative protein, causes signaling events in cell division that lead to changes in cell proliferation associated with cell-cell contact. The protein has both mouse and yeast orthologs.The protein encoded by this gene binds to an anti-proliferative protein, B-cell translocation protein 1, which negatively regulates cell proliferation. Binding of the two proteins, which is driven by phosphorylation of the anti-proliferative protein, causes signaling events in cell division that lead to changes in cell proliferation associated with cell-cell contact. The protein has both mouse and yeast orthologs. Alternate splicing of this gene results in two transcript variants encoding different isoforms.
Uniprot IDQ9UIV1
Protein Accession #NP_037486
Nucleotide Accession #NM_013354
Protein Size (# AA)262
Molecular Weight30kDa
Protein InteractionsFBXW11; TOB2; BTG2; FOXC2; UBC; BAG3; CNOT6; AGO2; AGO1; EPAS1; APP; ELAVL1; BTG1; Cnot3; HOXD4; IKBKG; BTG3; TOB1; CDK6; CDK4; CDK2; CDK1; PABPC1;
  1. What is the species homology for "CNOT7 Antibody - N-terminal region (ARP39026_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit, Yeast, Zebrafish".

  2. How long will it take to receive "CNOT7 Antibody - N-terminal region (ARP39026_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "CNOT7 Antibody - N-terminal region (ARP39026_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "CNOT7 Antibody - N-terminal region (ARP39026_P050)"?

    This target may also be called "CAF1, CAF-1, Caf1a, hCAF-1" in publications.

  5. What is the shipping cost for "CNOT7 Antibody - N-terminal region (ARP39026_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "CNOT7 Antibody - N-terminal region (ARP39026_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "CNOT7 Antibody - N-terminal region (ARP39026_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "30kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "CNOT7 Antibody - N-terminal region (ARP39026_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "CNOT7"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "CNOT7"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "CNOT7"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "CNOT7"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "CNOT7"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "CNOT7"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:CNOT7 Antibody - N-terminal region (ARP39026_P050)
Your Rating
We found other products you might like!