Search Antibody, Protein, and ELISA Kit Solutions

CNOT7 Antibody - N-terminal region (ARP39026_P050)

100 ul

Regular Price: $289.00

Special Price: $229.00

In Stock
Request Bulk Order Quote

Conjugation Options

ARP39026_P050-FITC Conjugated

ARP39026_P050-HRP Conjugated

ARP39026_P050-Biotin Conjugated

Tested Species Reactivity:
Predicted Species Reactivity:
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:
Official Gene Full Name:
CCR4-NOT transcription complex, subunit 7
NCBI Gene Id:
Protein Name:
CCR4-NOT transcription complex subunit 7
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
CAF1, hCAF-1
Replacement Item:
This antibody may replace item sc-101009 from Santa Cruz Biotechnology.
Description of Target:
CNOT7 binds to an anti-proliferative protein, B-cell translocation protein 1, which negatively regulates cell proliferation. Binding of the two proteins, which is driven by phosphorylation of the anti-proliferative protein, causes signaling events in cell division that lead to changes in cell proliferation associated with cell-cell contact. The protein has both mouse and yeast orthologs.The protein encoded by this gene binds to an anti-proliferative protein, B-cell translocation protein 1, which negatively regulates cell proliferation. Binding of the two proteins, which is driven by phosphorylation of the anti-proliferative protein, causes signaling events in cell division that lead to changes in cell proliferation associated with cell-cell contact. The protein has both mouse and yeast orthologs. Alternate splicing of this gene results in two transcript variants encoding different isoforms.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express CNOT7.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express CNOT7.
The immunogen is a synthetic peptide directed towards the N terminal region of human CNOT7
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 79%; Zebrafish: 100%
Complete computational species homology data:
Anti-CNOT7 (ARP39026_P050)
Peptide Sequence:
Synthetic peptide located within the following region: TEFPGVVARPIGEFRSNADYQYQLLRCNVDLLKIIQLGLTFMNEQGEYPP
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-CNOT7 (ARP39026_P050) antibody is Catalog # AAP39026 (Previous Catalog # AAPS03806)
Printable datasheet for anti-CNOT7 (ARP39026_P050) antibody
Sample Type Confirmation:

CNOT7 is supported by BioGPS gene expression data to be expressed in HepG2

Target Reference:
Kimura,K., (2006) Genome Res. 16 (1), 55-65

Maragozidis, P. et al. Alterations of deadenylase expression in acute leukemias: evidence for poly(a)-specific ribonuclease as a potential biomarker. Acta Haematol. 128, 39-46 (2012). IHC, WB, Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish 22614729

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...