Size:100 ul
Special Price $229.00 Regular Price $289.00
In Stock
Request Bulk
Order Quote
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email:
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP39026_P050-FITC Conjugated

ARP39026_P050-HRP Conjugated

ARP39026_P050-Biotin Conjugated

CNOT7 Antibody - N-terminal region (ARP39026_P050)

Catalog#: ARP39026_P050
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application IHC, WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-101009 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human CNOT7
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 79%; Zebrafish: 100%
Complete computational species homology data Anti-CNOT7 (ARP39026_P050)
Peptide Sequence Synthetic peptide located within the following region: TEFPGVVARPIGEFRSNADYQYQLLRCNVDLLKIIQLGLTFMNEQGEYPP
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-CNOT7 (ARP39026_P050) antibody is Catalog # AAP39026 (Previous Catalog # AAPS03806)
Datasheets/Manuals Printable datasheet for anti-CNOT7 (ARP39026_P050) antibody
Sample Type Confirmation

CNOT7 is supported by BioGPS gene expression data to be expressed in HepG2

Subunit 7
Target Reference Kimura,K., (2006) Genome Res. 16 (1), 55-65

Maragozidis, P. et al. Alterations of deadenylase expression in acute leukemias: evidence for poly(a)-specific ribonuclease as a potential biomarker. Acta Haematol. 128, 39-46 (2012). IHC, WB, Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish 22614729

Gene Symbol CNOT7
Official Gene Full Name CCR4-NOT transcription complex, subunit 7
Alias Symbols CAF1, hCAF-1
NCBI Gene Id 29883
Protein Name CCR4-NOT transcription complex subunit 7
Description of Target CNOT7 binds to an anti-proliferative protein, B-cell translocation protein 1, which negatively regulates cell proliferation. Binding of the two proteins, which is driven by phosphorylation of the anti-proliferative protein, causes signaling events in cell division that lead to changes in cell proliferation associated with cell-cell contact. The protein has both mouse and yeast orthologs.The protein encoded by this gene binds to an anti-proliferative protein, B-cell translocation protein 1, which negatively regulates cell proliferation. Binding of the two proteins, which is driven by phosphorylation of the anti-proliferative protein, causes signaling events in cell division that lead to changes in cell proliferation associated with cell-cell contact. The protein has both mouse and yeast orthologs. Alternate splicing of this gene results in two transcript variants encoding different isoforms.
Swissprot Id Q9UIV1
Protein Accession # NP_037486
Nucleotide Accession # NM_013354
Protein Size (# AA) 262
Molecular Weight 30kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express CNOT7.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express CNOT7.
Protein Interactions FBXW11; TOB2; BTG2; FOXC2; UBC; BAG3; CNOT6; AGO2; AGO1; EPAS1; APP; ELAVL1; BTG1; Cnot3; HOXD4; IKBKG; BTG3; TOB1; CDK6; CDK4; CDK2; CDK1; PABPC1;
  1. What is the species homology for "CNOT7 Antibody - N-terminal region (ARP39026_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish".

  2. How long will it take to receive "CNOT7 Antibody - N-terminal region (ARP39026_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "CNOT7 Antibody - N-terminal region (ARP39026_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact

  4. What are other names for "CNOT7 Antibody - N-terminal region (ARP39026_P050)"?

    This target may also be called "CAF1, hCAF-1" in publications.

  5. What is the shipping cost for "CNOT7 Antibody - N-terminal region (ARP39026_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "CNOT7 Antibody - N-terminal region (ARP39026_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "CNOT7 Antibody - N-terminal region (ARP39026_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "30kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "CNOT7 Antibody - N-terminal region (ARP39026_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "CNOT7"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "CNOT7"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "CNOT7"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "CNOT7"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "CNOT7"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "CNOT7"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:CNOT7 Antibody - N-terminal region (ARP39026_P050)
Your Rating
We found other products you might like!