Size:100 ul
Special Price $229.00 Regular Price $289.00
In stock
Request Bulk
Order Quote
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email:
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP39026_P050-FITC Conjugated

ARP39026_P050-HRP Conjugated

ARP39026_P050-Biotin Conjugated

CNOT7 Antibody - N-terminal region (ARP39026_P050)

Catalog#: ARP39026_P050
Domestic: within 1-2 days delivery International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application IHC, WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-101009 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human CNOT7
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 79%; Zebrafish: 100%
Complete computational species homology data Anti-CNOT7 (ARP39026_P050)
Peptide Sequence Synthetic peptide located within the following region: TEFPGVVARPIGEFRSNADYQYQLLRCNVDLLKIIQLGLTFMNEQGEYPP
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-CNOT7 (ARP39026_P050) antibody is Catalog # AAP39026 (Previous Catalog # AAPS03806)
Datasheets/Manuals Printable datasheet for anti-CNOT7 (ARP39026_P050) antibody
Sample Type Confirmation

CNOT7 is supported by BioGPS gene expression data to be expressed in HepG2

Subunit 7
Target Reference Kimura,K., (2006) Genome Res. 16 (1), 55-65

Maragozidis, P. et al. Alterations of deadenylase expression in acute leukemias: evidence for poly(a)-specific ribonuclease as a potential biomarker. Acta Haematol. 128, 39-46 (2012). IHC, WB, Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish 22614729

Gene Symbol CNOT7
Official Gene Full Name CCR4-NOT transcription complex, subunit 7
Alias Symbols CAF1, hCAF-1
NCBI Gene Id 29883
Protein Name CCR4-NOT transcription complex subunit 7
Description of Target CNOT7 binds to an anti-proliferative protein, B-cell translocation protein 1, which negatively regulates cell proliferation. Binding of the two proteins, which is driven by phosphorylation of the anti-proliferative protein, causes signaling events in cell division that lead to changes in cell proliferation associated with cell-cell contact. The protein has both mouse and yeast orthologs.The protein encoded by this gene binds to an anti-proliferative protein, B-cell translocation protein 1, which negatively regulates cell proliferation. Binding of the two proteins, which is driven by phosphorylation of the anti-proliferative protein, causes signaling events in cell division that lead to changes in cell proliferation associated with cell-cell contact. The protein has both mouse and yeast orthologs. Alternate splicing of this gene results in two transcript variants encoding different isoforms.
Swissprot Id Q9UIV1
Protein Accession # NP_037486
Nucleotide Accession # NM_013354
Protein Size (# AA) 262
Molecular Weight 30kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express CNOT7.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express CNOT7.
Protein Interactions FBXW11; TOB2; BTG2; FOXC2; UBC; BAG3; CNOT6; AGO2; AGO1; EPAS1; APP; ELAVL1; BTG1; Cnot3; HOXD4; IKBKG; BTG3; TOB1; CDK6; CDK4; CDK2; CDK1; PABPC1;
Write Your Own Review
You're reviewing:CNOT7 Antibody - N-terminal region (ARP39026_P050)
Your Rating