CLCN6 Antibody - C-terminal region (ARP73793_P050)

Catalog No: ARP73793_P050

Host: Rabbit
Target Name: CLCN6
Sample Type: Jurkat Whole Cell lysates
Antibody Dilution: 1.0ug/ml

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human CLCN6
• Purification: Affinity Purified
• Peptide Sequence: Synthetic peptide located within the following region: RYTPYPNLYPDQSPSEDWTMEERFRPLTFHGLILRSQLVTLLVRGVCYSE
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-CLCN6 (ARP73793_P050) antibody is Catalog # AAP73793

Target Info

• Gene Symbol: CLCN6
• Alias Symbols: CLC-6, CONRIBA
• NCBI Gene Id: 1185
• Description of Target: This gene encodes a member of the voltage-dependent chloride channel protein family. Members of this family can function as either chloride channels or antiporters. This protein is primarily localized to late endosomes and functions as a chloride/proton antiporter. Alternate splicing results in both coding and non-coding variants. Additional alternately spliced variants have been described but their full-length structure is unknown.
• Uniprot ID: P51797-6
• Protein Accession #: NP_001277
• Protein Size (# AA): 847
• Molecular Weight: 93kDa
• Protein Interactions: UBC; PPP2R1A;