Search Antibody, Protein, and ELISA Kit Solutions

CLCN6 antibody - C-terminal region (ARP35334_T100)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP35334_T100-FITC Conjugated

ARP35334_T100-HRP Conjugated

ARP35334_T100-Biotin Conjugated

Gene Symbol:
NCBI Gene Id:
Official Gene Full Name:
Chloride channel, voltage-sensitive 6
Protein Name:
Chloride transport protein 6
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Replacement Item:
This antibody may replace item sc-16439 from Santa Cruz Biotechnology.
Description of Target:
The CLCN family of voltage-dependent chloride channel genes comprises nine members (CLCN1-7, Ka and Kb) which demonstrate quite diverse functional characteristics while sharing significant sequence homology. Chloride channel 6 and 7 belong to a subbranch of this family. Chloride channel 6 has four different alternatively spliced transcript variants. This gene is in close vicinity to two other kidney-specific chloride channel genes, CLCNKA and CLCNKB.
Protein Size (# AA):
Molecular Weight:
Protein A purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express CLCN6.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express CLCN6.
The immunogen is a synthetic peptide directed towards the C terminal region of human CLCN6
Tested Species Reactivity:
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Complete computational species homology data:
Anti-CLCN6 (ARP35334_T100)
Peptide Sequence:
Synthetic peptide located within the following region: PQFQSISLRKIQFNFPYFRSDRDKRDFVSAGAAAGVAAAFGAPIGGTLFS
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-CLCN6 (ARP35334_T100) antibody is Catalog # AAP35334 (Previous Catalog # AAPP07254)
Printable datasheet for anti-CLCN6 (ARP35334_T100) antibody
Target Reference:
Tran,P., et al., (2002) Mamm. Genome 13 (9), 483-492

Jensen, V. K. et al. A quantitative assay for lysosomal acidification rates in human osteoclasts. Assay Drug Dev. Technol. 9, 157-64 (2011). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 21050068

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...