Size:100 ul
$229.00
In stock
SKU
ARP35334_T100
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP35334_T100-FITC Conjugated

ARP35334_T100-HRP Conjugated

ARP35334_T100-Biotin Conjugated

CLCN6 Antibody - C-terminal region (ARP35334_T100)

Catalog#: ARP35334_T100
Domestic: within 1-2 days delivery International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-16439 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human CLCN6
Purification Protein A purified
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Complete computational species homology data Anti-CLCN6 (ARP35334_T100)
Peptide Sequence Synthetic peptide located within the following region: PQFQSISLRKIQFNFPYFRSDRDKRDFVSAGAAAGVAAAFGAPIGGTLFS
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-CLCN6 (ARP35334_T100) antibody is Catalog # AAP35334 (Previous Catalog # AAPP07254)
Datasheets/Manuals Printable datasheet for anti-CLCN6 (ARP35334_T100) antibody
Target Reference Tran,P., et al., (2002) Mamm. Genome 13 (9), 483-492
Publications

Jensen, V. K. et al. A quantitative assay for lysosomal acidification rates in human osteoclasts. Assay Drug Dev. Technol. 9, 157-64 (2011). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 21050068

Gene Symbol CLCN6
Official Gene Full Name Chloride channel, voltage-sensitive 6
Alias Symbols CLC-6
NCBI Gene Id 1185
Protein Name Chloride transport protein 6
Description of Target The CLCN family of voltage-dependent chloride channel genes comprises nine members (CLCN1-7, Ka and Kb) which demonstrate quite diverse functional characteristics while sharing significant sequence homology. Chloride channel 6 and 7 belong to a subbranch of this family. Chloride channel 6 has four different alternatively spliced transcript variants. This gene is in close vicinity to two other kidney-specific chloride channel genes, CLCNKA and CLCNKB.
Swissprot Id Q5SNX3
Protein Accession # NP_068504
Nucleotide Accession # NM_021736
Protein Size (# AA) 353
Molecular Weight 39kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express CLCN6.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express CLCN6.
Protein Interactions UBC; PPP2R1A;
Write Your Own Review
You're reviewing:CLCN6 Antibody - C-terminal region (ARP35334_T100)
Your Rating