Search Antibody, Protein, and ELISA Kit Solutions

CCNT1 Antibody - middle region (ARP97420_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Gene Symbol:
CCNT1
Official Gene Full Name:
cyclin T1
NCBI Gene Id:
904
Protein Name:
Cyclin-T1
Swissprot Id:
O60563
Protein Accession #:
NP_001231.2
Nucleotide Accession #:
NM_001240.3
Alias Symbols:
CCNT, CYCT1, HIVE1
Description of Target:
This gene encodes a member of the highly conserved cyclin C subfamily. The encoded protein tightly associates with cyclin-dependent kinase 9, and is a major subunit of positive transcription elongation factor b (p-TEFb). In humans, there are multiple forms of positive transcription elongation factor b, which may include one of several different cyclins along with cyclin-dependent kinase 9. The complex containing the encoded cyclin and cyclin-dependent kinase 9 acts as a cofactor of human immunodeficiency virus type 1 (HIV-1) Tat protein, and is both necessary and sufficient for full activation of viral transcription. This cyclin and its kinase partner are also involved in triggering transcript elongation through phosphorylation of the carboxy-terminal domain of the largest RNA polymerase II subunit. Overexpression of this gene is implicated in tumor growth. Alternative splicing results in multiple transcript variants.
Protein Size (# AA):
726
Molecular Weight:
79 kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express CCNT1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express CCNT1.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human CCNT1
Predicted Species Reactivity:
Human
Tested Species Reactivity:
Human
Peptide Sequence:
Synthetic peptide located within the following region: SLPQDGSNAFISQKQNSKSVPSAKVSLKEYRAKHAEELAAQKRQLENMEA
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-CCNT1 (ARP97420_P050) antibody is Catalog # AAP97420
Datasheets/Manuals:
Printable datasheet for anti-CCNT1 (ARP97420_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...