Product Number |
ARP97420_P050 |
Product Page |
www.avivasysbio.com/ccnt1-antibody-middle-region-arp97420-p050.html |
Name |
CCNT1 Antibody - middle region (ARP97420_P050) |
Protein Size (# AA) |
726 amino acids |
Molecular Weight |
79 kDa |
NCBI Gene Id |
904 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
cyclin T1 |
Alias Symbols |
CCNT, CYCT1, HIVE1 |
Peptide Sequence |
Synthetic peptide located within the following region: SLPQDGSNAFISQKQNSKSVPSAKVSLKEYRAKHAEELAAQKRQLENMEA |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Description of Target |
This gene encodes a member of the highly conserved cyclin C subfamily. The encoded protein tightly associates with cyclin-dependent kinase 9, and is a major subunit of positive transcription elongation factor b (p-TEFb). In humans, there are multiple forms of positive transcription elongation factor b, which may include one of several different cyclins along with cyclin-dependent kinase 9. The complex containing the encoded cyclin and cyclin-dependent kinase 9 acts as a cofactor of human immunodeficiency virus type 1 (HIV-1) Tat protein, and is both necessary and sufficient for full activation of viral transcription. This cyclin and its kinase partner are also involved in triggering transcript elongation through phosphorylation of the carboxy-terminal domain of the largest RNA polymerase II subunit. Overexpression of this gene is implicated in tumor growth. Alternative splicing results in multiple transcript variants. |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-CCNT1 (ARP97420_P050) antibody |
Blocking Peptide |
For anti-CCNT1 (ARP97420_P050) antibody is Catalog # AAP97420 |
Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human CCNT1 |
Uniprot ID |
O60563 |
Protein Name |
Cyclin-T1 |
Protein Accession # |
NP_001231.2 |
Purification |
Affinity purified |
Nucleotide Accession # |
NM_001240.3 |
Tested Species Reactivity |
Human |
Gene Symbol |
CCNT1 |
Predicted Species Reactivity |
Human |
Application |
WB |
Image 1 | Human PANC1 Whole Cell
| Host: Rabbit Target Name: CCNT1 Sample Tissue: Human PANC1 Whole Cell lysates Antibody Dilution: 1ug/ml |
|
|