Search Antibody, Protein, and ELISA Kit Solutions

CAMK4 Antibody - N-terminal region (ARP61351_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP61351_P050-FITC Conjugated

ARP61351_P050-HRP Conjugated

ARP61351_P050-Biotin Conjugated

Gene Symbol:
CAMK4
Official Gene Full Name:
Calcium/calmodulin-dependent protein kinase IV
NCBI Gene Id:
814
Protein Name:
Calcium/calmodulin-dependent protein kinase type IV
Swissprot Id:
Q16566
Protein Accession #:
NP_001735
Nucleotide Accession #:
NM_001744
Alias Symbols:
CaMK-GR, MGC36771, IV, caMK, CaMK IV
Replacement Item:
This antibody may replace item sc-114186 from Santa Cruz Biotechnology.
Description of Target:
The product of this gene belongs to the serine/threonine protein kinase family, and to the Ca(2+)/calmodulin-dependent protein kinase subfamily. This enzyme is a multifunctional serine/threonine protein kinase with limited tissue distribution, that has been implicated in transcriptional regulation in lymphocytes, neurons and male germ cells.
Protein Size (# AA):
473
Molecular Weight:
52kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express CAMK4.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express CAMK4.
Predicted Species Reactivity:
Dog, Horse, Human, Mouse, Rat, Zebrafish
Tested Species Reactivity:
Human
Predicted Homology Based on Immunogen Sequence:
Dog: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Zebrafish: 79%
Complete computational species homology data:
Anti-CAMK4 (ARP61351_P050)
Peptide Sequence:
Synthetic peptide located within the following region: GRGATSIVYRCKQKGTQKPYALKVLKKTVDKKIVRTEIGVLLRLSHPNII
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
UBC; HSP90AA1; NOTCH1; RBPJ; NEDD4; CABIN1; HDAC4; CAMKK1; CAMK4; CAMKK2; CREBBP; RELA; NOS1; GAPDH;
Blocking Peptide:
For anti-CAMK4 (ARP61351_P050) antibody is Catalog # AAP61351 (Previous Catalog # AAPP47831)
Datasheets/Manuals:
Printable datasheet for anti-CAMK4 (ARP61351_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...