| Sku |
AAP61351 |
| Old sku |
AAPP47831 |
| Price |
$99.00 |
| Name |
CAMK4 Peptide - N-terminal region (AAP61351) |
| Purchase info |
To purchase this peptide:
- Copy peptide sku
- Click on this link
- Paste into field "Peptide Sku"
|
| Size |
100ug |
| Gene |
CAMK4 |
| Alias symbols |
CaMK-GR, MGC36771, IV, caMK, CaMK IV |
| Gene id |
814 |
| Description of target |
The product of this gene belongs to the serine/threonine protein kinase family, and to the Ca(2+)/calmodulin-dependent protein kinase subfamily. This enzyme is a multifunctional serine/threonine protein kinase with limited tissue distribution, that has been implicated in transcriptional regulation in lymphocytes, neurons and male germ cells. |
| Swissprot id |
Q16566 |
| Protein accession num |
NP_001735 |
| Nucleotide accession num |
NM_001744 |
| Protein size |
473 amino acids |
| Molecular weight |
52kDa |
| Species reactivity |
Human |
| Application |
WB |
| Peptide sequence |
GRGATSIVYRCKQKGTQKPYALKVLKKTVDKKIVRTEIGVLLRLSHPNII |
| Quality control |
The peptide is characterized by mass spectroscopy |
| Key reference |
N/A |
| Description |
This is a synthetic peptide designed for use in combination with anti-CAMK4 Antibody (ARP61351_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details. |
| Product format |
Lyophilized powder |
| Reconstitution and storage |
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles. |
| Lead time |
Domestic: within 24 hours delivery International: 3-5 business days |
| Protocol |
|
| Tips |
See our General FAQ page. |
| Availability |
In Stock |
