Search Antibody, Protein, and ELISA Kit Solutions

ATRX Antibody - C-terminal region (ARP47775_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP47775_P050-FITC Conjugated

ARP47775_P050-HRP Conjugated

ARP47775_P050-Biotin Conjugated

Gene Symbol:
ATRX
Official Gene Full Name:
similar to putative DNA dependent ATPase and helicase
NCBI Gene Id:
546
Protein Name:
Transcriptional regulator ATRX
Swissprot Id:
P46100-6
Replacement Item:
This antibody may replace item sc-10078 from Santa Cruz Biotechnology.
Description of Target:
The protein encoded by this gene contains an ATPase/helicase domain, and thus it belongs to the SWI/SNF family of chromatin remodeling proteins. The mutations of this gene are associated with an X-linked mental retardation (XLMR) syndrome most often accompanied by alpha-thalassemia (ATRX) syndrome. These mutations have been shown to cause diverse changes in the pattern of DNA methylation, which may provide a link between chromatin remodeling, DNA methylation, and gene expression in developmental processes. This protein is found to undergo cell cycle-dependent phosphorylation, which regulates its nuclear matrix and chromatin association, and suggests its involvement in the gene regulation at interphase and chromosomal segregation in mitosis. Multiple alternatively spliced transcript variants encoding distinct isoforms have been reported.
Protein Size (# AA):
1350
Molecular Weight:
148kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express ATRX.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express ATRX.
Immunogen:
The immunogen is a synthetic peptide directed towards the C-terminal region of Human ATRX
Predicted Species Reactivity:
Dog, Human, Pig, Rabbit
Tested Species Reactivity:
Human
Predicted Homology Based on Immunogen Sequence:
Dog: 88%; Human: 100%; Pig: 93%; Rabbit: 75%
Complete computational species homology data:
Anti-ATRX (ARP47775_P050)
Peptide Sequence:
Synthetic peptide located within the following region: DQSDETSEDDKKQSKKGTEEKKKPSDFKKKVIKMEQQYESSSDGTEKLPE
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
SUMO2; SUMO3; RAD51; H3F3A; PRKDC; PML; NBN; MRE11A; HIST1H1C; XRCC6; DAXX; SUPT16H; RAD50; HIST1H4J; HIST2H2BE; HIST1H2BL; HIST1H2AB; XRCC5; TP53; SSRP1; RPA1; RAD9A; RAD1; ZNF512B; UL82; NEK1; BLM; HIST2H3C; ZBED1; UBC; SVIL; CALM1; WRN; HIST1H3A; CBX5;
Blocking Peptide:
For anti-ATRX (ARP47775_P050) antibody is Catalog # AAP47775
Datasheets/Manuals:
Printable datasheet for anti-ATRX (ARP47775_P050) antibody
Sample Type Confirmation:

ATRX is strongly supported by BioGPS gene expression data to be expressed in Jurkat

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...