Search Antibody, Protein, and ELISA Kit Solutions

ARHGAP15 Antibody - middle region (ARP57262_P050)

Click here to learn more about Aviva's By-Request Conjugation Service.
100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP57262_P050-FITC Conjugated

ARP57262_P050-HRP Conjugated

ARP57262_P050-Biotin Conjugated

Click here to learn more about Aviva's By-Request Conjugation Service.
Gene Symbol:
Official Gene Full Name:
Rho GTPase activating protein 15
NCBI Gene Id:
Protein Name:
Rho GTPase-activating protein 15
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Description of Target:
RHO GTPases (see ARHA; MIM 165390) regulate diverse biologic processes, and their activity is regulated by RHO GTPase-activating proteins (GAPs), such as ARHGAP15 (Seoh et al., 2003 [PubMed 12650940]).
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express ARHGAP15.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express ARHGAP15.
The immunogen is a synthetic peptide directed towards the middle region of human ARHGAP15
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Tested Species Reactivity:
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 92%
Complete computational species homology data:
Anti-ARHGAP15 (ARP57262_P050)
Peptide Sequence:
Synthetic peptide located within the following region: VKSRLKKFITRRPSLKTLQEKGLIKDQIFGSHLHKVCERENSTVPWFVKQ
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-ARHGAP15 (ARP57262_P050) antibody is Catalog # AAP57262 (Previous Catalog # AAPP41023)
Printable datasheet for anti-ARHGAP15 (ARP57262_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...