| Product Number |
ARP57262_P050 |
| Product Page |
www.avivasysbio.com/arhgap15-antibody-middle-region-arp57262-p050.html |
| Name |
ARHGAP15 Antibody - middle region (ARP57262_P050) |
| Protein Size (# AA) |
475 amino acids |
| Molecular Weight |
54kDa |
| NCBI Gene Id |
55843 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Rho GTPase activating protein 15 |
| Alias Symbols |
BM046 |
| Peptide Sequence |
Synthetic peptide located within the following region: VKSRLKKFITRRPSLKTLQEKGLIKDQIFGSHLHKVCERENSTVPWFVKQ |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
RHO GTPases (see ARHA; MIM 165390) regulate diverse biologic processes, and their activity is regulated by RHO GTPase-activating proteins (GAPs), such as ARHGAP15 (Seoh et al., 2003 [PubMed 12650940]). |
| Protein Interactions |
UBC; KDM1A; CD93; PRNP; SNCA; SMURF1; RAC1; TGFBR1; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-ARHGAP15 (ARP57262_P050) antibody |
| Blocking Peptide |
For anti-ARHGAP15 (ARP57262_P050) antibody is Catalog # AAP57262 (Previous Catalog # AAPP41023) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human ARHGAP15 |
| Uniprot ID |
Q53QZ3 |
| Protein Name |
Rho GTPase-activating protein 15 |
| Protein Accession # |
NP_060930 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_018460 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
ARHGAP15 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 92% |
| Image 1 | Human 293T
 | WB Suggested Anti-ARHGAP15 Antibody Titration: 0.2-1 ug/ml
Positive Control: 293T cell lysate |
|
| Image 2 | Human Adult Placenta
 | Host: Rabbit
Target Name: ARHGAP15
Sample Type: Human Adult Placenta
Antibody Dilution: 1.0ug/ml |
|
