Catalog No: ARP40014_T100
Price: $0.00
SKU
ARP40014_T100
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-APTX (ARP40014_T100) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationIHC, WB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the C terminal region of human APTX
PurificationProtein A purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 92%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Peptide SequenceSynthetic peptide located within the following region: VIEMVQEAGRVTVRDGMPELLKLPLRCHECQQLLPSIPQLKEHLRKHWTQ
Concentration1.0 mg/ml
Blocking PeptideFor anti-APTX (ARP40014_T100) antibody is Catalog # AAP40014 (Previous Catalog # AAPP21922)
ReferenceAhnesorg,P., (2006) Cell 124 (2), 301-313
Publications

Dopeso, H. et al. Aprataxin tumor levels predict response of colorectal cancer patients to irinotecan-based treatment. Clin. Cancer Res. 16, 2375-82 (2010). 20371676

Gene SymbolAPTX
Gene Full NameAprataxin
Alias SymbolsAOA, AOA1, AXA1, EAOH, EOAHA, FHA-HIT
NCBI Gene Id54840
Protein NameAprataxin
Description of TargetAPTX is a member of the histidine triad (HIT) superfamily, some of which have nucleotide-binding and diadenosine polyphosphate hydrolase activities. APTX may play a role in single-stranded DNA repair. Mutations in this gene have been associated with ataxia-ocular apraxia.This gene encodes a member of the histidine triad (HIT) superfamily, some of which have nucleotide-binding and diadenosine polyphosphate hydrolase activities. The encoded protein may play a role in single-stranded DNA repair. Mutations in this gene have been associated with ataxia-ocular apraxia. Multiple transcript variants encoding distinct isoforms have been identified for this gene, however, the full length nature of some variants has not been determined.This gene encodes a member of the histidine triad (HIT) superfamily, some of which have nucleotide-binding and diadenosine polyphosphate hydrolase activities. The encoded protein may play a role in single-stranded DNA repair. Mutations in this gene have been associated with ataxia-ocular apraxia. Multiple transcript variants encoding distinct isoforms have been identified for this gene, however, the full length nature of some variants has not been determined.
Uniprot IDQ6JV85
Protein Accession #NP_778243
Nucleotide Accession #NM_175073
Protein Size (# AA)342
Molecular Weight38kDa
Protein InteractionsPNMA1; UBC; SUMO1; NEDD8; LIG3; HSPA4; XRCC1; DDX21; CNTROB; TSPYL2; CALCOCO1; SYT17; ZNF639; MAPKBP1; CEP350; PICK1; XRCC4; TRIM37; MBP; HIVEP1; BANF1; PARP1; TP53;
  1. What is the species homology for "APTX Antibody - C-terminal region (ARP40014_T100)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit".

  2. How long will it take to receive "APTX Antibody - C-terminal region (ARP40014_T100)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "APTX Antibody - C-terminal region (ARP40014_T100)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "APTX Antibody - C-terminal region (ARP40014_T100)"?

    This target may also be called "AOA, AOA1, AXA1, EAOH, EOAHA, FHA-HIT" in publications.

  5. What is the shipping cost for "APTX Antibody - C-terminal region (ARP40014_T100)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "APTX Antibody - C-terminal region (ARP40014_T100)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "APTX Antibody - C-terminal region (ARP40014_T100)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "38kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "APTX Antibody - C-terminal region (ARP40014_T100)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "APTX"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "APTX"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "APTX"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "APTX"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "APTX"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "APTX"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:APTX Antibody - C-terminal region (ARP40014_T100)
Your Rating
We found other products you might like!