Search Antibody, Protein, and ELISA Kit Solutions

APTX Antibody - C-terminal region (ARP40014_T100)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP40014_T100-FITC Conjugated

ARP40014_T100-HRP Conjugated

ARP40014_T100-Biotin Conjugated

Tested Species Reactivity:
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:
Official Gene Full Name:
NCBI Gene Id:
Protein Name:
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Replacement Item:
This antibody may replace item sc-365849 from Santa Cruz Biotechnology.
Description of Target:
APTX is a member of the histidine triad (HIT) superfamily, some of which have nucleotide-binding and diadenosine polyphosphate hydrolase activities. APTX may play a role in single-stranded DNA repair. Mutations in this gene have been associated with ataxia-ocular apraxia.This gene encodes a member of the histidine triad (HIT) superfamily, some of which have nucleotide-binding and diadenosine polyphosphate hydrolase activities. The encoded protein may play a role in single-stranded DNA repair. Mutations in this gene have been associated with ataxia-ocular apraxia. Multiple transcript variants encoding distinct isoforms have been identified for this gene, however, the full length nature of some variants has not been determined.This gene encodes a member of the histidine triad (HIT) superfamily, some of which have nucleotide-binding and diadenosine polyphosphate hydrolase activities. The encoded protein may play a role in single-stranded DNA repair. Mutations in this gene have been associated with ataxia-ocular apraxia. Multiple transcript variants encoding distinct isoforms have been identified for this gene, however, the full length nature of some variants has not been determined.
Protein Size (# AA):
Molecular Weight:
Protein A purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express APTX.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express APTX.
The immunogen is a synthetic peptide directed towards the C terminal region of human APTX
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 92%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Complete computational species homology data:
Anti-APTX (ARP40014_T100)
Peptide Sequence:
Synthetic peptide located within the following region: VIEMVQEAGRVTVRDGMPELLKLPLRCHECQQLLPSIPQLKEHLRKHWTQ
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-APTX (ARP40014_T100) antibody is Catalog # AAP40014 (Previous Catalog # AAPP21922)
Printable datasheet for anti-APTX (ARP40014_T100) antibody
Target Reference:
Ahnesorg,P., (2006) Cell 124 (2), 301-313

Dopeso, H. et al. Aprataxin tumor levels predict response of colorectal cancer patients to irinotecan-based treatment. Clin. Cancer Res. 16, 2375-82 (2010). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 20371676

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...