Size:100 ul
$229.00
In Stock
SKU
ARP40014_T100
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP40014_T100-FITC Conjugated

ARP40014_T100-HRP Conjugated

ARP40014_T100-Biotin Conjugated

APTX Antibody - C-terminal region (ARP40014_T100)

Catalog#: ARP40014_T100
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species ReactivityHuman
Predicted Species ReactivityCow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationIHC, WB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement ItemThis antibody may replace item sc-365849 from Santa Cruz Biotechnology.
ImmunogenThe immunogen is a synthetic peptide directed towards the C terminal region of human APTX
PurificationProtein A purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 92%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Complete computational species homology dataAnti-APTX (ARP40014_T100)
Peptide SequenceSynthetic peptide located within the following region: VIEMVQEAGRVTVRDGMPELLKLPLRCHECQQLLPSIPQLKEHLRKHWTQ
ConcentrationBatch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking PeptideFor anti-APTX (ARP40014_T100) antibody is Catalog # AAP40014 (Previous Catalog # AAPP21922)
Datasheets/ManualsPrintable datasheet for anti-APTX (ARP40014_T100) antibody
Target ReferenceAhnesorg,P., (2006) Cell 124 (2), 301-313
Publications

Dopeso, H. et al. Aprataxin tumor levels predict response of colorectal cancer patients to irinotecan-based treatment. Clin. Cancer Res. 16, 2375-82 (2010). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 20371676

Gene SymbolAPTX
Official Gene Full NameAprataxin
Alias SymbolsAOA, AOA1, AXA1, EAOH, EOAHA, FHA-HIT
NCBI Gene Id54840
Protein NameAprataxin
Description of TargetAPTX is a member of the histidine triad (HIT) superfamily, some of which have nucleotide-binding and diadenosine polyphosphate hydrolase activities. APTX may play a role in single-stranded DNA repair. Mutations in this gene have been associated with ataxia-ocular apraxia.This gene encodes a member of the histidine triad (HIT) superfamily, some of which have nucleotide-binding and diadenosine polyphosphate hydrolase activities. The encoded protein may play a role in single-stranded DNA repair. Mutations in this gene have been associated with ataxia-ocular apraxia. Multiple transcript variants encoding distinct isoforms have been identified for this gene, however, the full length nature of some variants has not been determined.This gene encodes a member of the histidine triad (HIT) superfamily, some of which have nucleotide-binding and diadenosine polyphosphate hydrolase activities. The encoded protein may play a role in single-stranded DNA repair. Mutations in this gene have been associated with ataxia-ocular apraxia. Multiple transcript variants encoding distinct isoforms have been identified for this gene, however, the full length nature of some variants has not been determined.
Swissprot IdQ6JV85
Protein Accession #NP_778243
Nucleotide Accession #NM_175073
Protein Size (# AA)342
Molecular Weight38kDa
Tissue ToolFind tissues and cell lines supported by DNA array analysis to express APTX.
RNA SeqFind tissues and cell lines supported by RNA-seq analysis to express APTX.
Protein InteractionsPNMA1; UBC; SUMO1; NEDD8; LIG3; HSPA4; XRCC1; DDX21; CNTROB; TSPYL2; CALCOCO1; SYT17; ZNF639; MAPKBP1; CEP350; PICK1; XRCC4; TRIM37; MBP; HIVEP1; BANF1; PARP1; TP53;
Write Your Own Review
You're reviewing:APTX Antibody - C-terminal region (ARP40014_T100)
Your Rating
Aviva Validation Data
Aviva Pathways
Assay Development
Free Microscope