Size:100 ul
In Stock
Request Bulk
Order Quote
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email:
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP36568_T100-FITC Conjugated

ARP36568_T100-HRP Conjugated

ARP36568_T100-Biotin Conjugated

ANXA1 Antibody - N-terminal region (ARP36568_T100)

Catalog#: ARP36568_T100
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species Reactivity Human, Mouse
Predicted Species Reactivity Cow, Dog, Guinea Pig, Human, Mouse, Rat
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application IHC, WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-11387, HPA011271
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human ANXA1
Purification Protein A purified
Predicted Homology Based on Immunogen Sequence Cow: 79%; Dog: 79%; Guinea Pig: 79%; Human: 100%; Mouse: 83%; Rat: 82%
Complete computational species homology data Anti-ANXA1 (ARP36568_T100)
Peptide Sequence Synthetic peptide located within the following region: WFIENEEQEYVQTVKSSKGGPGSAVSPYPTFNPSSDVAALHKAIMVKGVD
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-ANXA1 (ARP36568_T100) antibody is Catalog # AAP36568 (Previous Catalog # AAPP07801)
Datasheets/Manuals Printable datasheet for anti-ANXA1 (ARP36568_T100) antibody
Target Reference Ernst,S., et al., (2004) J. Immunol. 172 (12), 7669-7676

Ishida, Y. et al. Carnosol, rosemary ingredient, induces apoptosis in adult T-cell leukemia/lymphoma cells via glutathione depletion: proteomic approach using fluorescent two-dimensional differential gel electrophoresis. Hum. Cell 27, 68-77 (2014). IHC, WB, Cow, Dog, Guinea Pig, Human, Mouse, Rat 24323765

Nordon, I. M. et al. Comparative proteomics reveals a systemic vulnerability in the vasculature of patients with abdominal aortic aneurysms. J. Vasc. Surg. 54, 1100-1108.e6 (2011). IHC, WB, Cow, Dog, Guinea Pig, Human, Mouse, Rat 21741794

Gene Symbol ANXA1
Official Gene Full Name Annexin A1
Alias Symbols ANX1, LPC1
NCBI Gene Id 301
Protein Name Annexin RuleBase RU003540
Description of Target ANXA1 encodes a protein that belongs to a family of Ca(2+)-dependent phospholipid binding proteins which have a molecular weight of approximately 35,000 to 40,000 and are preferentially located on the cytosolic face of the plasma membrane. Annexin I protein has an apparent relative molecular mass of 40 kDa, with phospholipase A2 inhibitory activity. Since phospholipase A2 is required for the biosynthesis of the potent mediators of inflammation, prostaglandins and leukotrienes, annexin I may have potential anti-inflammatory activity.
Swissprot Id P04083
Protein Accession # NP_000691
Nucleotide Accession # NM_000700
Protein Size (# AA) 346
Molecular Weight 38kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express ANXA1.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express ANXA1.
Protein Interactions UBC; MEIS2; SUMO2; SUMO3; WWOX; ZBTB1; HECW2; YWHAQ; ATP4A; UBD; BAG3; HMGA1; VCAM1; ITGA4; FN1; ATF2; ANXA4; RIPK1; IKBKG; RELA; CUL5; CDK2; SIRT7; ANXA5; ANXA1; KLHL23; LRIF1; OTUB1; C1orf123; CSAD; C14orf1; FAF1; COPS6; CCT7; KMT2B; UNC119; SUMO1; UBE2
  1. What is the species homology for "ANXA1 Antibody - N-terminal region (ARP36568_T100)"?

    The tested species reactivity for this item is "Human, Mouse". This antibody is predicted to have homology to "Cow, Dog, Guinea Pig, Human, Mouse, Rat".

  2. How long will it take to receive "ANXA1 Antibody - N-terminal region (ARP36568_T100)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "ANXA1 Antibody - N-terminal region (ARP36568_T100)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact

  4. What are other names for "ANXA1 Antibody - N-terminal region (ARP36568_T100)"?

    This target may also be called "ANX1, LPC1" in publications.

  5. What is the shipping cost for "ANXA1 Antibody - N-terminal region (ARP36568_T100)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "ANXA1 Antibody - N-terminal region (ARP36568_T100)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "ANXA1 Antibody - N-terminal region (ARP36568_T100)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "38kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "ANXA1 Antibody - N-terminal region (ARP36568_T100)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "ANXA1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "ANXA1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "ANXA1"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "ANXA1"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "ANXA1"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "ANXA1"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:ANXA1 Antibody - N-terminal region (ARP36568_T100)
Your Rating
We found other products you might like!