Search Antibody, Protein, and ELISA Kit Solutions

ANXA1 Antibody - N-terminal region (ARP36568_T100)

100 ul
$249.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP36568_T100-FITC Conjugated

ARP36568_T100-HRP Conjugated

ARP36568_T100-Biotin Conjugated

Tested Species Reactivity:
Human, Mouse
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Human, Mouse, Rat
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality:
Polyclonal
Host:
Rabbit
Application:
IHC, WB
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:
ANXA1
Official Gene Full Name:
Annexin A1
NCBI Gene Id:
301
Protein Name:
Annexin RuleBase RU003540
Swissprot Id:
P04083
Protein Accession #:
NP_000691
Nucleotide Accession #:
NM_000700
Alias Symbols:
ANX1, LPC1
Replacement Item:
This antibody may replace item sc-11387, HPA011271
Description of Target:
ANXA1 encodes a protein that belongs to a family of Ca(2+)-dependent phospholipid binding proteins which have a molecular weight of approximately 35,000 to 40,000 and are preferentially located on the cytosolic face of the plasma membrane. Annexin I protein has an apparent relative molecular mass of 40 kDa, with phospholipase A2 inhibitory activity. Since phospholipase A2 is required for the biosynthesis of the potent mediators of inflammation, prostaglandins and leukotrienes, annexin I may have potential anti-inflammatory activity.
Protein Size (# AA):
346
Molecular Weight:
38kDa
Purification:
Protein A purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express ANXA1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express ANXA1.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human ANXA1
Predicted Homology Based on Immunogen Sequence:
Cow: 79%; Dog: 79%; Guinea Pig: 79%; Human: 100%; Mouse: 83%; Rat: 82%
Complete computational species homology data:
Anti-ANXA1 (ARP36568_T100)
Peptide Sequence:
Synthetic peptide located within the following region: WFIENEEQEYVQTVKSSKGGPGSAVSPYPTFNPSSDVAALHKAIMVKGVD
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
UBC; MEIS2; SUMO2; SUMO3; WWOX; ZBTB1; HECW2; YWHAQ; ATP4A; UBD; BAG3; HMGA1; VCAM1; ITGA4; FN1; ATF2; ANXA4; RIPK1; IKBKG; RELA; CUL5; CDK2; SIRT7; ANXA5; ANXA1; KLHL23; LRIF1; OTUB1; C1orf123; CSAD; C14orf1; FAF1; COPS6; CCT7; KMT2B; UNC119; SUMO1; UBE2
Blocking Peptide:
For anti-ANXA1 (ARP36568_T100) antibody is Catalog # AAP36568 (Previous Catalog # AAPP07801)
Datasheets/Manuals:
Printable datasheet for anti-ANXA1 (ARP36568_T100) antibody
Target Reference:
Ernst,S., et al., (2004) J. Immunol. 172 (12), 7669-7676
Publications:

Ishida, Y. et al. Carnosol, rosemary ingredient, induces apoptosis in adult T-cell leukemia/lymphoma cells via glutathione depletion: proteomic approach using fluorescent two-dimensional differential gel electrophoresis. Hum. Cell 27, 68-77 (2014). IHC, WB, Cow, Dog, Guinea Pig, Human, Mouse, Rat 24323765

Nordon, I. M. et al. Comparative proteomics reveals a systemic vulnerability in the vasculature of patients with abdominal aortic aneurysms. J. Vasc. Surg. 54, 1100-1108.e6 (2011). IHC, WB, Cow, Dog, Guinea Pig, Human, Mouse, Rat 21741794

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...