ANXA1 Antibody - N-terminal region (ARP36568_T100)

Data Sheet
 
Product Number ARP36568_T100
Product Page www.avivasysbio.com/anxa1-antibody-n-terminal-region-arp36568-t100.html
Name ANXA1 Antibody - N-terminal region (ARP36568_T100)
Protein Size (# AA) 346 amino acids
Molecular Weight 39 kDa
NCBI Gene Id 301
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name Annexin A1
Alias Symbols ANX1, LPC1
Peptide Sequence Synthetic peptide located within the following region: WFIENEEQEYVQTVKSSKGGPGSAVSPYPTFNPSSDVAALHKAIMVKGVD
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Ernst,S., et al., (2004) J. Immunol. 172 (12), 7669-7676
Description of Target ANXA1 encodes a protein that belongs to a family of Ca(2+)-dependent phospholipid binding proteins which have a molecular weight of approximately 35,000 to 40,000 and are preferentially located on the cytosolic face of the plasma membrane. Annexin I protein has an apparent relative molecular mass of 40 kDa, with phospholipase A2 inhibitory activity. Since phospholipase A2 is required for the biosynthesis of the potent mediators of inflammation, prostaglandins and leukotrienes, annexin I may have potential anti-inflammatory activity.
Protein Interactions UBC; MEIS2; SUMO2; SUMO3; WWOX; ZBTB1; HECW2; YWHAQ; ATP4A; UBD; BAG3; HMGA1; VCAM1; ITGA4; FN1; ATF2; ANXA4; RIPK1; IKBKG; RELA; CUL5; CDK2; SIRT7; ANXA5; ANXA1; KLHL23; LRIF1; OTUB1; C1orf123; CSAD; C14orf1; FAF1; COPS6; CCT7; KMT2B; UNC119; SUMO1; UBE2
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Enhanced Validation
Relative Expression (Western Blot) Avivasheild
Datasheets/Manuals Printable datasheet for anti-ANXA1 (ARP36568_T100) antibody
Blocking Peptide For anti-ANXA1 (ARP36568_T100) antibody is Catalog # AAP36568 (Previous Catalog # AAPP07801)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human ANXA1
Uniprot ID P04083
Protein Name Annexin RuleBase RU003540
Publications

Ishida, Y. et al. Carnosol, rosemary ingredient, induces apoptosis in adult T-cell leukemia/lymphoma cells via glutathione depletion: proteomic approach using fluorescent two-dimensional differential gel electrophoresis. Hum. Cell 27, 68-77 (2014). 24323765

Nordon, I. M. et al. Comparative proteomics reveals a systemic vulnerability in the vasculature of patients with abdominal aortic aneurysms. J. Vasc. Surg. 54, 1100-1108.e6 (2011). 21741794

Protein Accession # NP_000691
Purification Protein A purified
Nucleotide Accession # NM_000700
Tested Species Reactivity Human, Mouse
Gene Symbol ANXA1
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig
Application IHC, WB
Predicted Homology Based on Immunogen Sequence Cow: 79%; Dog: 79%; Guinea Pig: 79%; Human: 100%; Mouse: 83%; Rat: 82%
Image 1
Human Intestine
Human Intestine
Image 2
Mouse fibroblasts
WB Suggested Anti-ANXA1 Antibody
Positive Control: Lane 1: 20ug mouse fibroblast lysates
Primary Antibody Dilution : 1:600
Secondary Antibody : Anti rabbit-HRP
Secondry Antibody Dilution : 1:2000
Submitted by: Anonymous
Image 3
Human ACHN
Host: Rabbit
Target Name: ANXA1
Sample Tissue: Human ACHN
Antibody Dilution: 1.0ug/ml
Image 4
A549, RPMI-8226
Host: Rabbit
Target: ANXA1
Positive control (+): A549 (N03)
Negative control (-): RPMI-8226 (N12)
Antibody concentration: 0.5ug/ml
Image 5
Western Blot
25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/mL of the antibody was used in this experiment.
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com