- Gene Symbol:
- ALG1
- NCBI Gene Id:
- 56052
- Official Gene Full Name:
- ALG1, chitobiosyldiphosphodolichol beta-mannosyltransferase
- Protein Name:
- chitobiosyldiphosphodolichol beta-mannosyltransferase
- Swissprot Id:
- B4DP08
- Protein Accession #:
- NP_061982.3
- Nucleotide Accession #:
- NM_019109.4
- Alias Symbols:
- HMT1, MT-1, CDG1K, HMAT1, HMT-1, Mat-1, hMat-1
- Replacement Item:
- This antibody may replace item sc-109883 from Santa Cruz Biotechnology.
- Description of Target:
- The enzyme encoded by this gene catalyzes the first mannosylation step in the biosynthesis of lipid-linked oligosaccharides. This gene is mutated in congenital disorder of glycosylation type Ik.
- Protein Size (# AA):
- 353
- Molecular Weight:
- 38kDa
- Host:
- Rabbit
- Clonality:
- Polyclonal
- Purification:
- Affinity Purified
- Application:
- WB
- Tissue Tool:
- Find tissues and cell lines supported by DNA array analysis to express ALG1.
- RNA Seq:
- Find tissues and cell lines supported by RNA-seq analysis to express ALG1.
- Immunogen:
- The immunogen is a synthetic peptide directed towards the C-terminal region of human ALG1
- Tested Species Reactivity:
- Human
- Predicted Homology Based on Immunogen Sequence:
- Cow: 86%; Dog: 93%; Guinea Pig: 92%; Human: 100%; Mouse: 86%; Rabbit: 86%; Rat: 92%
- Peptide Sequence:
- Synthetic peptide located within the following region: VKHEENGLVFEDSEELAAQLQMLFSNFPDPAGKLNQFRKNLRESQQLRWD
- Product Format:
- Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
- Reconstitution and Storage:
- For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
- Concentration:
- Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
- Blocking Peptide:
- For anti-ALG1 (ARP49252_P050) antibody is Catalog # AAP49252
- Datasheets/Manuals:
- Printable datasheet for anti-ALG1 (ARP49252_P050) antibody
- Publications:
Rind, N. et al. A severe human metabolic disease caused by deficiency of the endoplasmatic mannosyltransferase hALG11 leads to congenital disorder of glycosylation-Ip. Hum. Mol. Genet. 19, 1413-24 (2010). WB, Cow, Dog, Guinea Pig, Human, Mouse, Rabbit, Rat 20080937
Product Reviews
- Protocol:
- Tips Information:
See our General FAQ page.
