ALG1 Antibody - C-terminal region (ARP49252_P050)

Catalog#: ARP49252_P050

• Size: 100 ul

• Gene Symbol: ALG1
• NCBI Gene Id: 56052
• Official Gene Full Name: ALG1, chitobiosyldiphosphodolichol beta-mannosyltransferase
• Protein Name: chitobiosyldiphosphodolichol beta-mannosyltransferase
• Swissprot Id: B4DP08
• Protein Accession #: NP_061982.3
• Nucleotide Accession #: NM_019109.4
• Alias Symbols: HMT1, MT-1, CDG1K, HMAT1, HMT-1, Mat-1, hMat-1
• Replacement Item: This antibody may replace item sc-109883 from Santa Cruz Biotechnology.
• Description of Target: The enzyme encoded by this gene catalyzes the first mannosylation step in the biosynthesis of lipid-linked oligosaccharides. This gene is mutated in congenital disorder of glycosylation type Ik.
• Protein Size (# AA): 353
• Molecular Weight: 38kDa
• Host: Rabbit
• Clonality: Polyclonal
• Purification: Affinity Purified
• Application: WB
• RNA Seq: Find tissues and cell lines supported by RNA-seq analysis to express ALG1.
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of human ALG1
• Tested Species Reactivity: Human
• Predicted Homology Based on Immunogen Sequence: Cow: 86%; Dog: 93%; Guinea Pig: 92%; Human: 100%; Mouse: 86%; Rabbit: 86%; Rat: 92%
• Peptide Sequence: Synthetic peptide located within the following region: VKHEENGLVFEDSEELAAQLQMLFSNFPDPAGKLNQFRKNLRESQQLRWD
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Concentration: Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
• Blocking Peptide: For anti-ALG1 (ARP49252_P050) antibody is Catalog # AAP49252
• Publications:

  Rind, N. et al. A severe human metabolic disease caused by deficiency of the endoplasmatic mannosyltransferase hALG11 leads to congenital disorder of glycosylation-Ip. Hum. Mol. Genet. 19, 1413-24 (2010). WB, Cow, Dog, Guinea Pig, Human, Mouse, Rabbit, Rat 20080937

Protocol:

• Reconstitution Instructions
• Immunohistochemistry (IHC) Protocol
• Immunocytochemistry (ICC) Protocol
• Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
• Western Blotting/Immunoblotting (WB/IB) Protocol
• Blocking Peptide Competition Protocol (BPCP)
• Immunoprecipitation (IP) Protocol

Tips Information:

• IHC Tips & Tricks
• ICC Tips & Tricks
• ELISA Tips & Tricks
• WB/IB Tips & Tricks
• IP Tips & Tricks

See our General FAQ page.