Size:100 ul
Special Price $229.00 Regular Price $289.00
In stock
SKU
ARP49252_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP49252_P050-FITC Conjugated

ARP49252_P050-HRP Conjugated

ARP49252_P050-Biotin Conjugated

ALG1 Antibody - C-terminal region (ARP49252_P050)

Catalog#: ARP49252_P050
Domestic: within 1-2 days delivery International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Dog, Guinea Pig, Human, Mouse, Rabbit, Rat
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-109883 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the C-terminal region of human ALG1
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 86%; Dog: 93%; Guinea Pig: 92%; Human: 100%; Mouse: 86%; Rabbit: 86%; Rat: 92%
Peptide Sequence Synthetic peptide located within the following region: VKHEENGLVFEDSEELAAQLQMLFSNFPDPAGKLNQFRKNLRESQQLRWD
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-ALG1 (ARP49252_P050) antibody is Catalog # AAP49252
Datasheets/Manuals Printable datasheet for anti-ALG1 (ARP49252_P050) antibody
Publications

Rind, N. et al. A severe human metabolic disease caused by deficiency of the endoplasmatic mannosyltransferase hALG11 leads to congenital disorder of glycosylation-Ip. Hum. Mol. Genet. 19, 1413-24 (2010). WB, Cow, Dog, Guinea Pig, Human, Mouse, Rabbit, Rat 20080937

Gene Symbol ALG1
Official Gene Full Name ALG1, chitobiosyldiphosphodolichol beta-mannosyltransferase
Alias Symbols HMT1, MT-1, CDG1K, HMAT1, HMT-1, Mat-1, hMat-1
NCBI Gene Id 56052
Protein Name chitobiosyldiphosphodolichol beta-mannosyltransferase
Description of Target The enzyme encoded by this gene catalyzes the first mannosylation step in the biosynthesis of lipid-linked oligosaccharides. This gene is mutated in congenital disorder of glycosylation type Ik.
Swissprot Id B4DP08
Protein Accession # NP_061982.3
Nucleotide Accession # NM_019109.4
Protein Size (# AA) 353
Molecular Weight 38kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express ALG1.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express ALG1.
Write Your Own Review
You're reviewing:ALG1 Antibody - C-terminal region (ARP49252_P050)
Your Rating