Search Antibody, Protein, and ELISA Kit Solutions

ALG1 Antibody - C-terminal region (ARP49252_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP49252_P050-FITC Conjugated

ARP49252_P050-HRP Conjugated

ARP49252_P050-Biotin Conjugated

Tested Species Reactivity:
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Human, Mouse, Rabbit, Rat
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:
Official Gene Full Name:
ALG1, chitobiosyldiphosphodolichol beta-mannosyltransferase
NCBI Gene Id:
Protein Name:
chitobiosyldiphosphodolichol beta-mannosyltransferase
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
HMT1, MT-1, CDG1K, HMAT1, HMT-1, Mat-1, hMat-1
Replacement Item:
This antibody may replace item sc-109883 from Santa Cruz Biotechnology.
Description of Target:
The enzyme encoded by this gene catalyzes the first mannosylation step in the biosynthesis of lipid-linked oligosaccharides. This gene is mutated in congenital disorder of glycosylation type Ik.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express ALG1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express ALG1.
The immunogen is a synthetic peptide directed towards the C-terminal region of human ALG1
Predicted Homology Based on Immunogen Sequence:
Cow: 86%; Dog: 93%; Guinea Pig: 92%; Human: 100%; Mouse: 86%; Rabbit: 86%; Rat: 92%
Peptide Sequence:
Synthetic peptide located within the following region: VKHEENGLVFEDSEELAAQLQMLFSNFPDPAGKLNQFRKNLRESQQLRWD
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-ALG1 (ARP49252_P050) antibody is Catalog # AAP49252
Printable datasheet for anti-ALG1 (ARP49252_P050) antibody

Rind, N. et al. A severe human metabolic disease caused by deficiency of the endoplasmatic mannosyltransferase hALG11 leads to congenital disorder of glycosylation-Ip. Hum. Mol. Genet. 19, 1413-24 (2010). WB, Cow, Dog, Guinea Pig, Human, Mouse, Rabbit, Rat 20080937

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...