ALG1 Antibody - C-terminal region (ARP49252_P050)

Size:100 ul

Human Uterus Tumor

Basic Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Cow, Dog, Guinea Pig, Human, Mouse, Rabbit, Rat
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Replacement Item: This antibody may replace item sc-109883 from Santa Cruz Biotechnology.
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of human ALG1
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 86%; Dog: 93%; Guinea Pig: 92%; Human: 100%; Mouse: 86%; Rabbit: 86%; Rat: 92%
• Peptide Sequence: Synthetic peptide located within the following region: VKHEENGLVFEDSEELAAQLQMLFSNFPDPAGKLNQFRKNLRESQQLRWD
• Concentration: Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
• Blocking Peptide: For anti-ALG1 (ARP49252_P050) antibody is Catalog # AAP49252
• Datasheets/Manuals: Printable datasheet for anti-ALG1 (ARP49252_P050) antibody
• Publications:

  Rind, N. et al. A severe human metabolic disease caused by deficiency of the endoplasmatic mannosyltransferase hALG11 leads to congenital disorder of glycosylation-Ip. Hum. Mol. Genet. 19, 1413-24 (2010). WB, Cow, Dog, Guinea Pig, Human, Mouse, Rabbit, Rat 20080937

Target Info

• Gene Symbol: ALG1
• Official Gene Full Name: ALG1, chitobiosyldiphosphodolichol beta-mannosyltransferase
• Alias Symbols: HMT1, MT-1, CDG1K, HMAT1, HMT-1, Mat-1, hMat-1
• NCBI Gene Id: 56052
• Protein Name: chitobiosyldiphosphodolichol beta-mannosyltransferase
• Description of Target: The enzyme encoded by this gene catalyzes the first mannosylation step in the biosynthesis of lipid-linked oligosaccharides. This gene is mutated in congenital disorder of glycosylation type Ik.
• Swissprot Id: B4DP08
• Protein Accession #: NP_061982.3
• Nucleotide Accession #: NM_019109.4
• Protein Size (# AA): 353
• Molecular Weight: 38kDa
• Tissue Tool: Find tissues and cell lines supported by DNA array analysis to express ALG1.
• RNA Seq: Find tissues and cell lines supported by RNA-seq analysis to express ALG1.