Size:100 ul
Special Price $229.00 Regular Price $289.00
In Stock
SKU
ARP49252_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP49252_P050-FITC Conjugated

ARP49252_P050-HRP Conjugated

ARP49252_P050-Biotin Conjugated

ALG1 Antibody - C-terminal region (ARP49252_P050)

Catalog#: ARP49252_P050
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Dog, Guinea Pig, Human, Mouse, Rabbit, Rat
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-109883 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the C-terminal region of human ALG1
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 86%; Dog: 93%; Guinea Pig: 92%; Human: 100%; Mouse: 86%; Rabbit: 86%; Rat: 92%
Peptide Sequence Synthetic peptide located within the following region: VKHEENGLVFEDSEELAAQLQMLFSNFPDPAGKLNQFRKNLRESQQLRWD
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-ALG1 (ARP49252_P050) antibody is Catalog # AAP49252
Datasheets/Manuals Printable datasheet for anti-ALG1 (ARP49252_P050) antibody
Publications

Rind, N. et al. A severe human metabolic disease caused by deficiency of the endoplasmatic mannosyltransferase hALG11 leads to congenital disorder of glycosylation-Ip. Hum. Mol. Genet. 19, 1413-24 (2010). WB, Cow, Dog, Guinea Pig, Human, Mouse, Rabbit, Rat 20080937

Gene Symbol ALG1
Official Gene Full Name ALG1, chitobiosyldiphosphodolichol beta-mannosyltransferase
Alias Symbols HMT1, MT-1, CDG1K, HMAT1, HMT-1, Mat-1, hMat-1
NCBI Gene Id 56052
Protein Name chitobiosyldiphosphodolichol beta-mannosyltransferase
Description of Target The enzyme encoded by this gene catalyzes the first mannosylation step in the biosynthesis of lipid-linked oligosaccharides. This gene is mutated in congenital disorder of glycosylation type Ik.
Swissprot Id B4DP08
Protein Accession # NP_061982.3
Nucleotide Accession # NM_019109.4
Protein Size (# AA) 353
Molecular Weight 38kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express ALG1.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express ALG1.
  1. What is the species homology for "ALG1 Antibody - C-terminal region (ARP49252_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Cow, Dog, Guinea Pig, Human, Mouse, Rabbit, Rat".

  2. How long will it take to receive "ALG1 Antibody - C-terminal region (ARP49252_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "ALG1 Antibody - C-terminal region (ARP49252_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "ALG1 Antibody - C-terminal region (ARP49252_P050)"?

    This target may also be called "HMT1, MT-1, CDG1K, HMAT1, HMT-1, Mat-1, hMat-1" in publications.

  5. What is the shipping cost for "ALG1 Antibody - C-terminal region (ARP49252_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "ALG1 Antibody - C-terminal region (ARP49252_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "ALG1 Antibody - C-terminal region (ARP49252_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "38kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "ALG1 Antibody - C-terminal region (ARP49252_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "ALG1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "ALG1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "ALG1"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "ALG1"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "ALG1"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "ALG1"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:ALG1 Antibody - C-terminal region (ARP49252_P050)
Your Rating
We found other products you might like!