Product Number |
ARP49252_P050 |
Product Page |
www.avivasysbio.com/alg1-antibody-c-terminal-region-arp49252-p050.html |
Name |
ALG1 Antibody - C-terminal region (ARP49252_P050) |
Protein Size (# AA) |
353 amino acids |
Molecular Weight |
38kDa |
NCBI Gene Id |
56052 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
ALG1, chitobiosyldiphosphodolichol beta-mannosyltransferase |
Alias Symbols |
HMT1, MT-1, CDG1K, HMAT1, HMT-1, Mat-1, hMat-1 |
Peptide Sequence |
Synthetic peptide located within the following region: VKHEENGLVFEDSEELAAQLQMLFSNFPDPAGKLNQFRKNLRESQQLRWD |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Description of Target |
The enzyme encoded by this gene catalyzes the first mannosylation step in the biosynthesis of lipid-linked oligosaccharides. This gene is mutated in congenital disorder of glycosylation type Ik. |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-ALG1 (ARP49252_P050) antibody |
Blocking Peptide |
For anti-ALG1 (ARP49252_P050) antibody is Catalog # AAP49252 |
Immunogen |
The immunogen is a synthetic peptide directed towards the C-terminal region of human ALG1 |
Uniprot ID |
B4DP08 |
Protein Name |
chitobiosyldiphosphodolichol beta-mannosyltransferase |
Publications |
Rind, N. et al. A severe human metabolic disease caused by deficiency of the endoplasmatic mannosyltransferase hALG11 leads to congenital disorder of glycosylation-Ip. Hum. Mol. Genet. 19, 1413-24 (2010). 20080937 |
Protein Accession # |
NP_061982.3 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_019109.4 |
Tested Species Reactivity |
Human |
Gene Symbol |
ALG1 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Rabbit |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 86%; Dog: 93%; Guinea Pig: 92%; Human: 100%; Mouse: 86%; Rabbit: 86%; Rat: 92% |
Image 1 | Human Uterus Tumor
| Host: Rabbit Target Name: ALG1 Sample Type: Uterus Tumor lysates Antibody Dilution: 1.0ug/ml |
|