ALG1 Antibody - C-terminal region (ARP49252_P050)

Data Sheet
 
Product Number ARP49252_P050
Product Page www.avivasysbio.com/alg1-antibody-c-terminal-region-arp49252-p050.html
Name ALG1 Antibody - C-terminal region (ARP49252_P050)
Protein Size (# AA) 353 amino acids
Molecular Weight 38kDa
NCBI Gene Id 56052
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name ALG1, chitobiosyldiphosphodolichol beta-mannosyltransferase
Alias Symbols HMT1, MT-1, CDG1K, HMAT1, HMT-1, Mat-1, hMat-1
Peptide Sequence Synthetic peptide located within the following region: VKHEENGLVFEDSEELAAQLQMLFSNFPDPAGKLNQFRKNLRESQQLRWD
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Description of Target The enzyme encoded by this gene catalyzes the first mannosylation step in the biosynthesis of lipid-linked oligosaccharides. This gene is mutated in congenital disorder of glycosylation type Ik.
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-ALG1 (ARP49252_P050) antibody
Blocking Peptide For anti-ALG1 (ARP49252_P050) antibody is Catalog # AAP49252
Immunogen The immunogen is a synthetic peptide directed towards the C-terminal region of human ALG1
Uniprot ID B4DP08
Protein Name chitobiosyldiphosphodolichol beta-mannosyltransferase
Publications

Rind, N. et al. A severe human metabolic disease caused by deficiency of the endoplasmatic mannosyltransferase hALG11 leads to congenital disorder of glycosylation-Ip. Hum. Mol. Genet. 19, 1413-24 (2010). 20080937

Protein Accession # NP_061982.3
Purification Affinity Purified
Nucleotide Accession # NM_019109.4
Tested Species Reactivity Human
Gene Symbol ALG1
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Rabbit
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 86%; Dog: 93%; Guinea Pig: 92%; Human: 100%; Mouse: 86%; Rabbit: 86%; Rat: 92%
Image 1
Human Uterus Tumor
Host: Rabbit
Target Name: ALG1
Sample Type: Uterus Tumor lysates
Antibody Dilution: 1.0ug/ml
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com