Search Antibody, Protein, and ELISA Kit Solutions

ALDOC Antibody - C-terminal region (ARP48274_P050)

Click here to learn more about Aviva's By-Request Conjugation Service.
100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP48274_P050-FITC Conjugated

ARP48274_P050-HRP Conjugated

ARP48274_P050-Biotin Conjugated

Click here to learn more about Aviva's By-Request Conjugation Service.
Gene Symbol:
ALDOC
Official Gene Full Name:
Aldolase C, fructose-bisphosphate
NCBI Gene Id:
230
Protein Name:
Fructose-bisphosphate aldolase C
Swissprot Id:
P09972
Protein Accession #:
NP_005156
Nucleotide Accession #:
NM_005165
Alias Symbols:
ALDC
Description of Target:
ALDOC gene is a member of the class I fructose-biphosphate aldolase gene family. ALDOC is a glycolytic enzyme that catalyzes the reversible aldol cleavage of fructose-1,6-biphosphate and fructose 1-phosphate to dihydroxyacetone phosphate and either glyceraldehyde-3-phosphate or glyceraldehyde, respectively.This gene encodes a member of the class I fructose-biphosphate aldolase gene family. Expressed specifically in the hippocampus and Purkinje cells of the brain, the encoded protein is a glycolytic enzyme that catalyzes the reversible aldol cleavage of fructose-1,6-biphosphate and fructose 1-phosphate to dihydroxyacetone phosphate and either glyceraldehyde-3-phosphate or glyceraldehyde, respectively.
Protein Size (# AA):
364
Molecular Weight:
39kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express ALDOC.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express ALDOC.
Immunogen:
The immunogen is a synthetic peptide directed towards the C terminal region of human ALDOC
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Tested Species Reactivity:
Human
Predicted Homology Based on Immunogen Sequence:
Cow: 93%; Dog: 92%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%; Zebrafish: 79%
Complete computational species homology data:
Anti-ALDOC (ARP48274_P050)
Peptide Sequence:
Synthetic peptide located within the following region: CPLPRPWALTFSYGRALQASALNAWRGQRDNAGAATEEFIKRAEVNGLAA
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
LNX1; ALDOA; UBC; TXNDC5; NSFL1C; HSPA1A; GNL1; HECW2; BAG3; SQLE; MAP2K3; Htt; OLA1; UBD; COPS5; PLD2; ATP6V1E1;
Blocking Peptide:
For anti-ALDOC (ARP48274_P050) antibody is Catalog # AAP48274 (Previous Catalog # AAPY01639)
Datasheets/Manuals:
Printable datasheet for anti-ALDOC (ARP48274_P050) antibody
Target Reference:
Kim,S.C., (2006) Mol. Cell 23 (4), 607-618

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...