ALDOC Antibody - C-terminal region (ARP48274_P050)

Data Sheet
 
Product Number ARP48274_P050
Product Page www.avivasysbio.com/aldoc-antibody-c-terminal-region-arp48274-p050.html
Name ALDOC Antibody - C-terminal region (ARP48274_P050)
Protein Size (# AA) 364 amino acids
Molecular Weight 39kDa
NCBI Gene Id 230
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Aldolase C, fructose-bisphosphate
Alias Symbols ALDC
Peptide Sequence Synthetic peptide located within the following region: CPLPRPWALTFSYGRALQASALNAWRGQRDNAGAATEEFIKRAEVNGLAA
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Kim,S.C., (2006) Mol. Cell 23 (4), 607-618
Description of Target ALDOC gene is a member of the class I fructose-biphosphate aldolase gene family. ALDOC is a glycolytic enzyme that catalyzes the reversible aldol cleavage of fructose-1,6-biphosphate and fructose 1-phosphate to dihydroxyacetone phosphate and either glyceraldehyde-3-phosphate or glyceraldehyde, respectively.This gene encodes a member of the class I fructose-biphosphate aldolase gene family. Expressed specifically in the hippocampus and Purkinje cells of the brain, the encoded protein is a glycolytic enzyme that catalyzes the reversible aldol cleavage of fructose-1,6-biphosphate and fructose 1-phosphate to dihydroxyacetone phosphate and either glyceraldehyde-3-phosphate or glyceraldehyde, respectively.
Protein Interactions LNX1; ALDOA; UBC; TXNDC5; NSFL1C; HSPA1A; GNL1; HECW2; BAG3; SQLE; MAP2K3; Htt; OLA1; UBD; COPS5; PLD2; ATP6V1E1;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-ALDOC (ARP48274_P050) antibody
Blocking Peptide For anti-ALDOC (ARP48274_P050) antibody is Catalog # AAP48274 (Previous Catalog # AAPY01639)
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human ALDOC
Uniprot ID P09972
Protein Name Fructose-bisphosphate aldolase C
Protein Accession # NP_005156
Purification Affinity Purified
Nucleotide Accession # NM_005165
Tested Species Reactivity Human
Gene Symbol ALDOC
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 93%; Dog: 92%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%; Zebrafish: 79%
Image 1
Human Placenta
WB Suggested Anti-ALDOC Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Human Placenta
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com