AFP Antibody - C-terminal region (ARP30347_T100)

Catalog No: ARP30347_T100

Host: Rabbit
Target Name: AFP
Sample Type: Fetal Brain lysates
Antibody Dilution: 3.0ug/ml

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Horse, Pig
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human AFP
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 91%; Pig: 91%; Rat: 91%
• Peptide Sequence: Synthetic peptide located within the following region: KPQITEEQLEAVIADFSGLLEKCCQGQEQEVCFAEEGQKLISKTRAALGV
• Concentration: 1.0 mg/ml
• Blocking Peptide: For anti-AFP (ARP30347_T100) antibody is Catalog # AAP30347

Target Info

• Gene Symbol: AFP
• Alias Symbols: AFPD, FETA, HPAFP
• NCBI Gene Id: 174
• Description of Target: This gene encodes alpha-fetoprotein, a major plasma protein produced by the yolk sac and the liver during fetal life. Alpha-fetoprotein expression in adults is often associated with hepatoma or teratoma. However, hereditary persistance of alpha-fetoprotein may also be found in individuals with no obvious pathology. The protein is thought to be the fetal counterpart of serum albumin, and the alpha-fetoprotein and albumin genes are present in tandem in the same transcriptional orientation on chromosome 4. Alpha-fetoprotein is found in monomeric as well as dimeric and trimeric forms, and binds copper, nickel, fatty acids and bilirubin. The level of alpha-fetoprotein in amniotic fluid is used to measure renal loss of protein to screen for spina bifida and anencephaly.
• Uniprot ID: P02771
• Protein Accession #: NP_001125
• Nucleotide Accession #: NM_001134
• Protein Size (# AA): 609
• Molecular Weight: 66kDa
• Protein Interactions: PIDD1; EHD4; PHB2; AP4S1; MED27; PSMB7; GNB1; XIAP; STAMBP; SGSM2; CCR5;