Loading...
Catalog No: AVARP00006_P050-HRP
Size:100ul
Price: $434.00
SKU
AVARP00006_P050-HRP
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.

ADRB2 Antibody - middle region : HRP (AVARP00006_P050-HRP)

Datasheets/ManualsPrintable datasheet for anti-ADRB2 (AVARP00006_P050-HRP) antibody
Product Info
Predicted Species ReactivityHuman
Product FormatLiquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
ClonalityPolyclonal
HostRabbit
ConjugationHRP: Horseradish Peroxidase
ApplicationWB
Reconstitution and StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human ADRB2
Predicted Homology Based on Immunogen SequenceHuman: 100%
Peptide SequenceSynthetic peptide located within the following region: TGEQSGYHVEQEKENKLLCEDLPGTEDFVGHQGTVPSDNIDSQGRNCSTN
Concentration0.5 mg/ml
Blocking PeptideFor anti-ADRB2 (AVARP00006_P050-HRP) antibody is Catalog # AAP30422 (Previous Catalog # AAPP01005)
ReferencePenco,S., (er) BMC Bioinformatics 9 (1), 254 (2008) In press
Gene SymbolADRB2
Gene Full NameAdrenergic, beta-2-, receptor, surface
Alias SymbolsBAR, B2AR, ADRBR, ADRB2R, BETA2AR
NCBI Gene Id154
Protein NameBeta-2 adrenergic receptor
Description of TargetThis protein is beta-2-adrenergic receptor which is a member of the G protein-coupled receptor superfamily. This receptor is directly associated with one of its ultimate effectors, the class C L-type calcium channel Ca(V)1.2. This receptor-channel complex also contains a G protein, an adenylyl cyclase, cAMP-dependent kinase, and the counterbalancing phosphatase, PP2A. The assembly of the signaling complex provides a mechanism that ensures specific and rapid signaling by this G protein-coupled receptor. This gene encodes beta-2-adrenergic receptor which is a member of the G protein-coupled receptor superfamily. This receptor is directly associated with one of its ultimate effectors, the class C L-type calcium channel Ca(V)1.2. This receptor-channel complex also contains a G protein, an adenylyl cyclase, cAMP-dependent kinase, and the counterbalancing phosphatase, PP2A. The assembly of the signaling complex provides a mechanism that ensures specific and rapid signaling by this G protein-coupled receptor. This gene is intronless. Different polymorphic forms, point mutations, and/or downregulation of this gene are associated with nocturnal asthma, obesity and type 2 diabetes. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Uniprot IDP07550
Protein Accession #NP_000015
Nucleotide Accession #NM_000024
Protein Size (# AA)413
Molecular Weight46kDa
Protein InteractionsARRDC3; REL; TSHR; TSG101; STAT4; STAT3; SNCG; RGS10; RGS2; RAN; RAB27A; RAB3A; CNN1; CD81; CD68; CD9; CD4; CCKBR; CEACAM1; ARRB2; ARHGDIA; ARHGAP5; HDAC6; GPR56; VAPA; RGS9; RGS11; RGS20; RGS5; VEGFB; VDAC2; VDAC1; KCTD13; ARRDC1; RGS8; SLC52A2; WNK1; RA
  1. What is the species homology for "ADRB2 Antibody - middle region : HRP (AVARP00006_P050-HRP)"?

    The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human".

  2. How long will it take to receive "ADRB2 Antibody - middle region : HRP (AVARP00006_P050-HRP)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "ADRB2 Antibody - middle region : HRP (AVARP00006_P050-HRP)" provided in?

    This item is provided in "Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "ADRB2 Antibody - middle region : HRP (AVARP00006_P050-HRP)"?

    This target may also be called "BAR, B2AR, ADRBR, ADRB2R, BETA2AR" in publications.

  5. What is the shipping cost for "ADRB2 Antibody - middle region : HRP (AVARP00006_P050-HRP)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "ADRB2 Antibody - middle region : HRP (AVARP00006_P050-HRP)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "ADRB2 Antibody - middle region : HRP (AVARP00006_P050-HRP)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "46kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "ADRB2 Antibody - middle region : HRP (AVARP00006_P050-HRP)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "ADRB2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "ADRB2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "ADRB2"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "ADRB2"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "ADRB2"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "ADRB2"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:ADRB2 Antibody - middle region : HRP (AVARP00006_P050-HRP)
Your Rating
We found other products you might like!