ADGRL1 Antibody - C-terminal region (ARP65781_P050)

Catalog#: ARP65781_P050
Domestic: within 1-2 days delivery International: 1-2 days

Human HeLa

Size:	100 ul
Price:	$289.00
Availability: In Stock
Qty:
Request Bulk Order Quote

Aviva's Satisfaction Guarantee

Conjugation Options

ARP65781_P050-FITC Conjugated

ARP65781_P050-HRP Conjugated

ARP65781_P050-Biotin Conjugated

Gene Symbol:: ADGRL1
Official Gene Full Name:: adhesion G protein-coupled receptor L1
NCBI Gene Id:: 22859
Protein Name:: adhesion G protein-coupled receptor L1
Swissprot Id:: O94910
Protein Accession #:: AAH07587
Nucleotide Accession #:: NM_001008701
Alias Symbols:: CL1, LEC2, CIRL1, LPHN1
Replacement Item:: This antibody may replace item sc-34484 from Santa Cruz Biotechnology.
Description of Target:: This gene encodes a member of the latrophilin subfamily of G-protein coupled receptors (GPCR). Latrophilins may function in both cell adhesion and signal transduction. In experiments with non-human species, endogenous proteolytic cleavage within a cysteine-rich GPS (G-protein-coupled-receptor proteolysis site) domain resulted in two subunits (a large extracellular N-terminal cell adhesion subunit and a subunit with substantial similarity to the secretin/calcitonin family of GPCRs) being non-covalently bound at the cell membrane. Latrophilin-1 has been shown to recruit the neurotoxin from black widow spider venom, alpha-latrotoxin, to the synapse plasma membrane. Alternative splicing results in multiple variants encoding distinct isoforms.
Protein Size (# AA):: 839
Molecular Weight:: 95kDa
Host:: Rabbit
Clonality:: Polyclonal
Purification:: Affinity Purified
Application:: WB
Tissue Tool:: Find tissues and cell lines supported by DNA array analysis to express ADGRL1.
RNA Seq:: Find tissues and cell lines supported by RNA-seq analysis to express ADGRL1.
Immunogen:: The immunogen is a synthetic peptide directed towards the C-terminal region of Human LPHN1
Predicted Species Reactivity:: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat
Tested Species Reactivity:: Human
Predicted Homology Based on Immunogen Sequence:: Cow: 93%; Dog: 86%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rat: 100%
Complete computational species homology data:: Anti-LPHN1 (ARP65781_P050)
Peptide Sequence:: Synthetic peptide located within the following region: YSLRSGDFPPGDGGPEPPRGRNLADAAAFEKMIISELVHNNLRGSSSAAK
Product Format:: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:: Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:: PSMA3; ELAVL1; UBC; CACNA1A; APC; ANKS1A; SHANK1; SHANK2; DLG4; DLG3; ROS1;
Blocking Peptide:: For anti-ADGRL1 (ARP65781_P050) antibody is Catalog # AAP65781
Datasheets/Manuals:: Printable datasheet for anti-ADGRL1 (ARP65781_P050) antibody