- Gene Symbol:
- ADGRL1
- NCBI Gene Id:
- 22859
- Official Gene Full Name:
- adhesion G protein-coupled receptor L1
- Protein Name:
- adhesion G protein-coupled receptor L1
- Swissprot Id:
- O94910
- Protein Accession #:
- AAH07587
- Nucleotide Accession #:
- NM_001008701
- Alias Symbols:
- CL1, LEC2, CIRL1, LPHN1
- Replacement Item:
- This antibody may replace item sc-34484 from Santa Cruz Biotechnology.
- Description of Target:
- This gene encodes a member of the latrophilin subfamily of G-protein coupled receptors (GPCR). Latrophilins may function in both cell adhesion and signal transduction. In experiments with non-human species, endogenous proteolytic cleavage within a cysteine-rich GPS (G-protein-coupled-receptor proteolysis site) domain resulted in two subunits (a large extracellular N-terminal cell adhesion subunit and a subunit with substantial similarity to the secretin/calcitonin family of GPCRs) being non-covalently bound at the cell membrane. Latrophilin-1 has been shown to recruit the neurotoxin from black widow spider venom, alpha-latrotoxin, to the synapse plasma membrane. Alternative splicing results in multiple variants encoding distinct isoforms.
- Protein Size (# AA):
- 839
- Molecular Weight:
- 95kDa
- Host:
- Rabbit
- Clonality:
- Polyclonal
- Purification:
- Affinity Purified
- Application:
- WB
- Tissue Tool:
- Find tissues and cell lines supported by DNA array analysis to express ADGRL1.
- RNA Seq:
- Find tissues and cell lines supported by RNA-seq analysis to express ADGRL1.
- Immunogen:
- The immunogen is a synthetic peptide directed towards the C-terminal region of Human LPHN1
- Tested Species Reactivity:
- Human
- Predicted Homology Based on Immunogen Sequence:
- Cow: 93%; Dog: 86%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rat: 100%
- Complete computational species homology data:
- Anti-LPHN1 (ARP65781_P050)
- Peptide Sequence:
- Synthetic peptide located within the following region: YSLRSGDFPPGDGGPEPPRGRNLADAAAFEKMIISELVHNNLRGSSSAAK
- Product Format:
- Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
- Reconstitution and Storage:
- For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
- Concentration:
- Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
- Protein Interactions:
- PSMA3; ELAVL1; UBC; CACNA1A; APC; ANKS1A; SHANK1; SHANK2; DLG4; DLG3; ROS1;
- Blocking Peptide:
- For anti-ADGRL1 (ARP65781_P050) antibody is Catalog # AAP65781
- Datasheets/Manuals:
- Printable datasheet for anti-ADGRL1 (ARP65781_P050) antibody
Product Reviews
- Protocol:
- Tips Information:
See our General FAQ page.
