ADGRL1 Antibody - C-terminal region (ARP65781_P050)

Data Sheet
 
Product Number ARP65781_P050
Product Page www.avivasysbio.com/adgrl1-antibody-c-terminal-region-arp65781-p050.html
Name ADGRL1 Antibody - C-terminal region (ARP65781_P050)
Protein Size (# AA) 839 amino acids
Molecular Weight 95kDa
NCBI Gene Id 22859
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name adhesion G protein-coupled receptor L1
Alias Symbols CL1, LEC2, CIRL1, LPHN1
Peptide Sequence Synthetic peptide located within the following region: YSLRSGDFPPGDGGPEPPRGRNLADAAAFEKMIISELVHNNLRGSSSAAK
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Description of Target This gene encodes a member of the latrophilin subfamily of G-protein coupled receptors (GPCR). Latrophilins may function in both cell adhesion and signal transduction. In experiments with non-human species, endogenous proteolytic cleavage within a cysteine-rich GPS (G-protein-coupled-receptor proteolysis site) domain resulted in two subunits (a large extracellular N-terminal cell adhesion subunit and a subunit with substantial similarity to the secretin/calcitonin family of GPCRs) being non-covalently bound at the cell membrane. Latrophilin-1 has been shown to recruit the neurotoxin from black widow spider venom, alpha-latrotoxin, to the synapse plasma membrane. Alternative splicing results in multiple variants encoding distinct isoforms.
Protein Interactions PSMA3; ELAVL1; UBC; CACNA1A; APC; ANKS1A; SHANK1; SHANK2; DLG4; DLG3; ROS1;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-ADGRL1 (ARP65781_P050) antibody
Blocking Peptide For anti-ADGRL1 (ARP65781_P050) antibody is Catalog # AAP65781
Immunogen The immunogen is a synthetic peptide directed towards the C-terminal region of Human LPHN1
Uniprot ID O94910
Protein Name adhesion G protein-coupled receptor L1
Protein Accession # AAH07587
Purification Affinity Purified
Nucleotide Accession # NM_001008701
Tested Species Reactivity Human
Gene Symbol ADGRL1
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 93%; Dog: 86%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rat: 100%
Image 1
Human HeLa
WB Suggested Anti-LPHN1 Antibody
Titration: 1.0 ug/ml
Positive Control: Hela Whole Cell
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com