ADCY10 Antibody - N-terminal region (ARP47448_P050)

Catalog No: ARP47448_P050

Click here to learn more about Aviva's By-Request Conjugation Service.

Host: Rabbit
Target Name: ADCY10
Sample Tissue: Human PANC1 Whole Cell lysates
Antibody Dilution: 1ug/ml

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ADCY10
• Purification: Affinity purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 92%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%
• Peptide Sequence: Synthetic peptide located within the following region: FTAMTEKFSSAMYMDRGAEQLVEILNYHISAIVEKVLIFGGDILKFAGDA
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-ADCY10 (ARP47448_P050) antibody is Catalog # AAP47448

Target Info

• Gene Symbol: ADCY10
• Gene Full Name: adenylate cyclase 10, soluble
• Alias Symbols: SAC, HCA2, SACI, Sacy, hsAC, HEL-S-7a
• NCBI Gene Id: 55811
• Protein Name: Adenylate cyclase type 10
• Description of Target: The protein encoded by this gene belongs to a distinct class of adenylyl cyclases that is soluble and insensitive to G protein or forskolin regulation. Activity of this protein is regulated by bicarbonate. Variation at this gene has been observed in patients with absorptive hypercalciuria. Alternatively spliced transcript variants encoding different isoforms have been observed. There is a pseudogene of this gene on chromosome 6.
• Uniprot ID: Q96PN6
• Protein Accession #: NP_060887
• Nucleotide Accession #: NM_018417.5
• Protein Size (# AA): 1610
• Molecular Weight: 177 kDa
• Protein Interactions: PTGIR; SSTR5;