Search Antibody, Protein, and ELISA Kit Solutions

SAC Antibody - N-terminal region (ARP47447_P050)

100 ul
$319.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP47447_P050-FITC Conjugated

ARP47447_P050-HRP Conjugated

ARP47447_P050-Biotin Conjugated

Tested Species Reactivity:
Human
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality:
Polyclonal
Host:
Rabbit
Application:
WB
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:
ADCY10
Official Gene Full Name:
Adenylate cyclase 10 (soluble)
NCBI Gene Id:
55811
Protein Name:
Adenylate cyclase type 10
Swissprot Id:
Q96PN6
Protein Accession #:
NP_060887
Nucleotide Accession #:
NM_018417
Alias Symbols:
HCA2, RP1-313L4.2, SACI, SAC, Sacy
Replacement Item:
This antibody may replace item sc-140593 from Santa Cruz Biotechnology.
Description of Target:
SAC belongs to a distinct class of mammalian adenylyl cyclase that is soluble and insensitive to G protein or forskolin regulation. It is localized in the cytoplasm and is thought to function as a general bicarbonate sensor throughout the body. It may also play an important role in the generation of cAMP in spermatozoa, implying possible roles in sperm maturation through the epididymis, capacitation, hypermotility, and/or the acrosome reaction.The protein encoded by this gene belongs to a distinct class of mammalian adenylyl cyclase that is soluble and insensitive to G protein or forskolin regulation. It is localized in the cytoplasm and is thought to function as a general bicarbonate sensor throughout the body. It may also play an important role in the generation of cAMP in spermatozoa, implying possible roles in sperm maturation through the epididymis, capacitation, hypermotility, and/or the acrosome reaction. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Protein Size (# AA):
1610
Molecular Weight:
187kDa
Purification:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express SAC.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express SAC.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human SAC
Predicted Homology Based on Immunogen Sequence:
Cow: 93%; Dog: 93%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Complete computational species homology data:
Anti-SAC (ARP47447_P050)
Peptide Sequence:
Synthetic peptide located within the following region: VGHTVRHEYTVIGQKVNLAARMMMYYPGIVTCDSVTYNGSNLPAYFFKEL
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
PTGIR; SSTR5;
Blocking Peptide:
For anti-ADCY10 (ARP47447_P050) antibody is Catalog # AAP47447 (Previous Catalog # AAPP28324)
Datasheets/Manuals:
Printable datasheet for anti-ADCY10 (ARP47447_P050) antibody
Target Reference:
Schmid,A., (2007) J. Gen. Physiol. 130 (1), 99-109
Publications:

Corredor, R. G. et al. Soluble adenylyl cyclase activity is necessary for retinal ganglion cell survival and axon growth. J. Neurosci. 32, 7734-44 (2012). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 22649251

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...