ACOX3 Antibody - C-terminal region (ARP60790_P050)

Catalog No: ARP60790_P050

WB Suggested Anti-ACOX3 Antibody
Titration: 1.0 ug/ml
Positive Control: 721_B Whole CellACOX3 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells

Host: Mouse
Target Name: ACOX3
Sample Tissue: Mouse Liver
Antibody Dilution: 1ug/ml

Product Info

• Tested Species Reactivity: Human, Mouse
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human ACOX3
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 93%; Guinea Pig: 86%; Horse: 100%; Human: 100%; Mouse: 93%; Pig: 100%; Rat: 93%; Zebrafish: 93%
• Peptide Sequence: Synthetic peptide located within the following region: SWTTQQGIQECREACGGHGYLAMNRLGVLRDDNDPNCTYEGDNNILLQQT
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-ACOX3 (ARP60790_P050) antibody is Catalog # AAP60790 (Previous Catalog # AAPP46979)
• Sample Type Confirmation:

  ACOX3 is strongly supported by BioGPS gene expression data to be expressed in 721_B

Target Info

• Gene Symbol: ACOX3
• Gene Full Name: Acyl-CoA oxidase 3, pristanoyl
• Alias Symbols: -
• NCBI Gene Id: 8310
• Protein Name: Peroxisomal acyl-coenzyme A oxidase 3
• Description of Target: Acyl-Coenzyme A oxidase 3 also know as pristanoyl -CoA oxidase (ACOX3)is involved in the desaturation of 2-methyl branched fatty acids in peroxisomes. Unlike the rat homolog, the human gene is expressed in very low amounts in liver such that its mRNA was undetectable by routine Northern-blot analysis or its product by immunoblotting or by enzyme activity measurements. However the human cDNA encoding a 700 amino acid protein with a peroxisomal targeting C-terminal tripeptide S-K-L was isolated and is thought to be expressed under special conditions such as specific developmental stages or in a tissue specific manner in tissues that have not yet been examined.
• Uniprot ID: O15254
• Protein Accession #: NP_003492
• Nucleotide Accession #: NM_003501
• Protein Size (# AA): 700
• Molecular Weight: 77kDa
• Protein Interactions: SMURF2; PEX5; UBC;