Search Antibody, Protein, and ELISA Kit Solutions

ACOT12 Antibody - middle region (ARP52535_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP52535_P050-FITC Conjugated

ARP52535_P050-HRP Conjugated

ARP52535_P050-Biotin Conjugated

Gene Symbol:
Official Gene Full Name:
Acyl-CoA thioesterase 12
NCBI Gene Id:
Protein Name:
Acyl-coenzyme A thioesterase 12
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
CACH-1, Cach, MGC105114, STARD15, THEAL
Replacement Item:
This antibody may replace item sc-107129 from Santa Cruz Biotechnology.
Description of Target:
ACOT12 contains 2 acyl coenzyme A hydrolase domains and 1 START domain. It hydrolyzes acetyl-CoA to acetate and CoA.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express ACOT12.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express ACOT12.
The immunogen is a synthetic peptide directed towards the middle region of human ACOT12
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Tested Species Reactivity:
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 86%
Complete computational species homology data:
Anti-ACOT12 (ARP52535_P050)
Peptide Sequence:
Synthetic peptide located within the following region: SASRLCWAHPFLKSVDMFKFRGPSTVGDRLVFTAIVNNTFQTCVEVGVRV
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-ACOT12 (ARP52535_P050) antibody is Catalog # AAP52535 (Previous Catalog # AAPP30448)
Printable datasheet for anti-ACOT12 (ARP52535_P050) antibody
Target Reference:
Hunt,M.C., (2006) FASEB J. 20 (11), 1855-1864

Li, B., Vachali, P., Frederick, J. M. & Bernstein, P. S. Identification of StARD3 as a lutein-binding protein in the macula of the primate retina. Biochemistry 50, 2541-9 (2011). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish 21322544

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...