Size:100 ul
Special Price $229.00 Regular Price $289.00
In stock
SKU
ARP52535_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP52535_P050-FITC Conjugated

ARP52535_P050-HRP Conjugated

ARP52535_P050-Biotin Conjugated

ACOT12 Antibody - middle region (ARP52535_P050)

Catalog#: ARP52535_P050
Domestic: within 1-2 days delivery International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-107129 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human ACOT12
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 86%
Complete computational species homology data Anti-ACOT12 (ARP52535_P050)
Peptide Sequence Synthetic peptide located within the following region: SASRLCWAHPFLKSVDMFKFRGPSTVGDRLVFTAIVNNTFQTCVEVGVRV
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-ACOT12 (ARP52535_P050) antibody is Catalog # AAP52535 (Previous Catalog # AAPP30448)
Datasheets/Manuals Printable datasheet for anti-ACOT12 (ARP52535_P050) antibody
Target Reference Hunt,M.C., (2006) FASEB J. 20 (11), 1855-1864
Publications

Li, B., Vachali, P., Frederick, J. M. & Bernstein, P. S. Identification of StARD3 as a lutein-binding protein in the macula of the primate retina. Biochemistry 50, 2541-9 (2011). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish 21322544

Gene Symbol ACOT12
Official Gene Full Name Acyl-CoA thioesterase 12
Alias Symbols CACH-1, Cach, MGC105114, STARD15, THEAL
NCBI Gene Id 134526
Protein Name Acyl-coenzyme A thioesterase 12
Description of Target ACOT12 contains 2 acyl coenzyme A hydrolase domains and 1 START domain. It hydrolyzes acetyl-CoA to acetate and CoA.
Swissprot Id Q8WYK0
Protein Accession # NP_570123
Nucleotide Accession # NM_130767
Protein Size (# AA) 555
Molecular Weight 62kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express ACOT12.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express ACOT12.
Write Your Own Review
You're reviewing:ACOT12 Antibody - middle region (ARP52535_P050)
Your Rating