| Product Number |
ARP52535_P050 |
| Product Page |
www.avivasysbio.com/acot12-antibody-middle-region-arp52535-p050.html |
| Name |
ACOT12 Antibody - middle region (ARP52535_P050) |
| Protein Size (# AA) |
555 amino acids |
| Molecular Weight |
62kDa |
| NCBI Gene Id |
134526 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Acyl-CoA thioesterase 12 |
| Alias Symbols |
Cach, THEAL, CACH-1, STARD15 |
| Peptide Sequence |
Synthetic peptide located within the following region: SASRLCWAHPFLKSVDMFKFRGPSTVGDRLVFTAIVNNTFQTCVEVGVRV |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Hunt,M.C., (2006) FASEB J. 20 (11), 1855-1864 |
| Description of Target |
ACOT12 contains 2 acyl coenzyme A hydrolase domains and 1 START domain. It hydrolyzes acetyl-CoA to acetate and CoA. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-ACOT12 (ARP52535_P050) antibody |
| Blocking Peptide |
For anti-ACOT12 (ARP52535_P050) antibody is Catalog # AAP52535 (Previous Catalog # AAPP30448) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human ACOT12 |
| Uniprot ID |
Q8WYK0 |
| Protein Name |
Acyl-coenzyme A thioesterase 12 |
| Publications |
Li, B., Vachali, P., Frederick, J. M. & Bernstein, P. S. Identification of StARD3 as a lutein-binding protein in the macula of the primate retina. Biochemistry 50, 2541-9 (2011). 21322544 |
| Protein Accession # |
NP_570123 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_130767 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
ACOT12 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 86% |
| Image 1 | Human 721_B
 | WB Suggested Anti-ACOT12 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:12500
Positive Control: 721_B cell lysate |
|
