SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP32790_T100
Price: $0.00
SKU
ARP32790_T100
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-ACAT2 (ARP32790_T100) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationIHC, WB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human ACAT2
PurificationProtein A purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 92%; Guinea Pig: 100%; Horse: 92%; Human: 100%; Mouse: 92%; Rabbit: 92%; Rat: 100%
Peptide SequenceSynthetic peptide located within the following region: SREDQDKVAVLSQNRTENAQKAGHFDKEIVPVLVSTRKGLIEVKTDEFPR
Concentration1.0 mg/ml
Blocking PeptideFor anti-ACAT2 (ARP32790_T100) antibody is Catalog # AAP32790 (Previous Catalog # AAPP03809)
Sample Type Confirmation

ACAT2 is supported by BioGPS gene expression data to be expressed in K562

ReferenceSakashita, N., et al., (2003) Invest. 83 (11), 1569-1581
Gene SymbolACAT2
Gene Full NameAcetyl-CoA acetyltransferase 2
Alias SymbolsACAT2, ACTL
NCBI Gene Id39
Protein NameAcetyl-CoA acetyltransferase, cytosolic
Description of TargetAcetyl-Coenzyme A acetyltransferase 2 is an enzyme involved in lipid metabolism. Reported patients with ACAT2 deficiency have shown severe mental retardation and hypotonus. The ACAT2 gene shows complementary overlapping with the 3-prime region of the TCP1 gene in both mouse and human. These genes are encoded on opposite strands of DNA, as well as in opposite transcriptional orientation.
Uniprot IDQ9BWD1
Protein Accession #NP_005882
Nucleotide Accession #NM_005891
Protein Size (# AA)397
Molecular Weight41kDa
Protein InteractionsCDKN2A; HBA1; CLU; SYK; BLOC1S6; SLC4A1AP; CA2; ANK1; RHAG; LYN; EPB41; CA4; CANX; SLC4A1; ACTC1; EPB42;
  1. What is the species homology for "ACAT2 Antibody - middle region (ARP32790_T100)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit".

  2. How long will it take to receive "ACAT2 Antibody - middle region (ARP32790_T100)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "ACAT2 Antibody - middle region (ARP32790_T100)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "ACAT2 Antibody - middle region (ARP32790_T100)"?

    This target may also be called "ACAT2, ACTL" in publications.

  5. What is the shipping cost for "ACAT2 Antibody - middle region (ARP32790_T100)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "ACAT2 Antibody - middle region (ARP32790_T100)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "ACAT2 Antibody - middle region (ARP32790_T100)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "41kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "ACAT2 Antibody - middle region (ARP32790_T100)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "ACAT2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "ACAT2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "ACAT2"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "ACAT2"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "ACAT2"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "ACAT2"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:ACAT2 Antibody - middle region (ARP32790_T100)
Your Rating
We found other products you might like!