ACAT2 Antibody - middle region (ARP32791_T100)

Catalog No: ARP32791_T100

WB Suggested Anti-ACAT2 Antibody Titration: 2.0ug/ml
Positive Control: K562 cell lysateACAT2 is supported by BioGPS gene expression data to be expressed in K562

Human Stomach

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Yeast
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: IHC, WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ACAT2
• Purification: Protein A purified
• Predicted Homology Based on Immunogen Sequence: Cow: 79%; Dog: 86%; Guinea Pig: 79%; Horse: 86%; Human: 100%; Mouse: 79%; Rat: 79%; Yeast: 82%
• Peptide Sequence: Synthetic peptide located within the following region: VLSQNRTENAQKAGHFDKEIVPVLVSTRKGLIEVKTDEFPRHGSNIEAMS
• Concentration: 1.0 mg/ml
• Blocking Peptide: For anti-ACAT2 (ARP32791_T100) antibody is Catalog # AAP32791 (Previous Catalog # AAPP03810)
• Sample Type Confirmation:

  ACAT2 is supported by BioGPS gene expression data to be expressed in K562

• Reference: Sakashita,N.,et al., (2003) Lab.Invest.83(11),1569-1581

Target Info

• Gene Symbol: ACAT2
• Gene Full Name: Acetyl-CoA acetyltransferase 2
• NCBI Gene Id: 39
• Protein Name: Acetyl-CoA acetyltransferase, cytosolic
• Description of Target: Acetyl-Coenzyme A acetyltransferase 2 is an enzyme involved in lipid metabolism. Reported patients with ACAT2 deficiency have shown severe mental retardation and hypotonus. The ACAT2 gene shows complementary overlapping with the 3-prime region of the TCP1 gene in both mouse and human. These genes are encoded on opposite strands of DNA, as well as in opposite transcriptional orientation.
• Uniprot ID: Q16146
• Protein Accession #: NP_005882
• Nucleotide Accession #: NM_005891
• Protein Size (# AA): 397
• Molecular Weight: 44kDa
• Protein Interactions: LNX1; ACAT2; UBC; SUMO2; OLA1; TUBB3; PAPSS1; UBA3; PKM; HMGB3; HEXA; FH; ALDH9A1; AHCY; BAG3; TTC39C; PSAT1; SSU72; DAK; VASP; TERF1; CDX2; CSNK2A1;