ACAA1 Recombinant Protein (Human) (OPCA01439)

Catalog No: OPCA01439

ACAA1 Recombinant Protein (Human) (OPCA01439) in SDS-PAGE showing the molecular weight of approximately 47.82 kDa.

ACAA1 Recombinant Protein (Human) (OPCA01439) in SDS-PAGE showing the molecular weight of approximately 47.82 kDa.

Product Info

• Predicted Species Reactivity: Homo sapiens|Human
• Product Format: Liquid or Lyophilized powder
• Host: Human
• Reconstitution and Storage: -20°C or -80°C
• Formulation: 20 mM Tris-HCl based buffer, pH 8.0
• Purity: Greater than 90% as determined by SDS-PAGE.
• Peptide Sequence: LSGAPQASAADVVVVHGRRTAICRAGRGGFKDTTPDELLSAVMTAVLKDVNLRPEQLGDICVGNVLQPGAGAIMARIAQFLSDIPETVPLSTVNRQCSSGLQAVASIAGGIRNGSYDIGMACGITSENVAERFGISREKQDTFALASQQKAARAQSKGCFQAEIVPVTTTVHDDKGTKRSITVTQDEGIRPSTTMEGLAKLKPAFKKDGSTTAGLTVSDVDIFEINEAFASQAAYCVEKLRLPPEKVNPLGGAVALGHPLGCTGARQVITLLNELKRRGKRAYGVVSMCIGTGMGAAAVFEYPGN
• Protein Sequence: LSGAPQASAADVVVVHGRRTAICRAGRGGFKDTTPDELLSAVMTAVLKDVNLRPEQLGDICVGNVLQPGAGAIMARIAQFLSDIPETVPLSTVNRQCSSGLQAVASIAGGIRNGSYDIGMACGITSENVAERFGISREKQDTFALASQQKAARAQSKGCFQAEIVPVTTTVHDDKGTKRSITVTQDEGIRPSTTMEGLAKLKPAFKKDGSTTAGLTVSDVDIFEINEAFASQAAYCVEKLRLPPEKVNPLGGAVALGHPLGCTGARQVITLLNELKRRGKRAYGVVSMCIGTGMGAAAVFEYPGN
• Storage Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: E.coli
• Protein Range: 27-331 aa
• Tag: N-terminal 6xHis-SUMO-tagged
• Reference: An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.Bian Y., Song C., Cheng K., Dong M., Wang F., Huang J., Sun D., Wang L., Ye M., Zou H.J. Proteomics 96:253-262(2014)

Target Info

• Gene Symbol: ACAA1
• Gene Full Name: acetyl-CoA acyltransferase 1
• Alias Symbols: 3-ketoacyl-CoA thiolase, peroxisomal;ACAA;Acetyl-CoA acyltransferase;acetyl-CoA C-myristoyltransferase;acetyl-Coenzyme A acyltransferase 1;beta-ketothiolase;epididymis secretory sperm binding protein;peroxisomal 3-oxoacyl-CoA thiolase;peroxisomal 3-oxoacyl-Coenzyme A thiolase;PTHIO;testicular tissue protein Li 197;THIO.
• NCBI Gene Id: 30
• Protein Name: 3-ketoacyl-CoA thiolase, peroxisomal
• Description of Target: This gene encodes an enzyme operative in the beta-oxidation system of the peroxisomes. Deficiency of this enzyme leads to pseudo-Zellweger syndrome. Alternative splicing results in multiple transcript variants.
• Uniprot ID: P09110
• Protein Accession #: NP_001123882.1
  
• Nucleotide Accession #: NM_001130410.1
• Protein Size (# AA): Recombinant
• Molecular Weight: 47.9 kDa