Aviva Systems Biology office will be closed for Christmas and New Year Holiday - December 24-25, 2018 and January 1, 2019.
Please go here for more info.

Now Offering Over 102,157 Antibodies & 44,722 Antigens!

ACAA1 antibody - N-terminal region (ARP48177_P050)

100 ul
$289.00
In Stock

Conjugation Options

ARP48177_P050-FITC Conjugated

ARP48177_P050-HRP Conjugated

ARP48177_P050-Biotin Conjugated

Gene Symbol:
ACAA1
NCBI Gene Id:
30
Official Gene Full Name:
Acetyl-CoA acyltransferase 1
Protein Name:
3-ketoacyl-CoA thiolase, peroxisomal
Swissprot Id:
P09110
Protein Accession #:
NP_001598
Nucleotide Accession #:
NM_001607
Alias Symbols:
ACAA, PTHIO, THIO
Replacement Item:
This antibody may replace item sc-171640, HPA007244
Description of Target:
ACAA1 is an enzyme operative in the beta-oxidation system of the peroxisomes. Deficiency of this enzyme leads to pseudo-Zellweger syndrome.Acetyl-Coenzyme A acyltransferase (ACAA1) is an enzyme operative in the beta-oxidation system of the peroxisomes. Deficiency of this enzyme leads to pseudo-Zellweger syndrome. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Protein Size (# AA):
424
Molecular Weight:
44kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB, IHC
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express ACAA1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express ACAA1.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human ACAA1
Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Predicted Homology Based on Immunogen Sequence:
Cow: 93%; Dog: 93%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 86%; Rabbit: 100%; Rat: 100%; Zebrafish: 86%
Complete computational species homology data:
Anti-ACAA1 (ARP48177_P050)
Peptide Sequence:
Synthetic peptide located within the following region: ADVVVVHGRRTAICRAGRGGFKDTTPDELLSAVMTAVLKDVNLRPEQLGD
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
UBC; TXNDC11; TRAPPC5; MRPL53; SARNP; SRPRB; SUGP1; SBDS; ZDHHC5; SF3B4; VDAC3; SCP2; RPS19; PPIB; NDUFA7; NDUFA2; HSD17B4; HAT1;
Blocking Peptide:
For anti-ACAA1 (ARP48177_P050) antibody is Catalog # AAP48177 (Previous Catalog # AAPP28686)
Datasheets/Manuals:
Printable datasheet for anti-ACAA1 (ARP48177_P050) antibody
Target Reference:
Park,H.C., (2005) Yonsei Med. J. 46 (6), 779-787

Tell us what you think about this item!

Write A Review
    Please, wait...