Search Antibody, Protein, and ELISA Kit Solutions

ACAA1 Antibody - N-terminal region (ARP48177_P050)

100 ul

Regular Price: $289.00

Special Price: $229.00

In Stock
Request Bulk Order Quote

Conjugation Options

ARP48177_P050-FITC Conjugated

ARP48177_P050-HRP Conjugated

ARP48177_P050-Biotin Conjugated

Tested Species Reactivity:
Human, Rat
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item:
This antibody may replace item sc-171640, HPA007244
The immunogen is a synthetic peptide directed towards the N terminal region of human ACAA1
Affinity Purified
Predicted Homology Based on Immunogen Sequence:
Cow: 93%; Dog: 93%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 86%; Rabbit: 100%; Rat: 100%; Zebrafish: 86%
Complete computational species homology data:
Anti-ACAA1 (ARP48177_P050)
Peptide Sequence:
Synthetic peptide located within the following region: ADVVVVHGRRTAICRAGRGGFKDTTPDELLSAVMTAVLKDVNLRPEQLGD
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-ACAA1 (ARP48177_P050) antibody is Catalog # AAP48177 (Previous Catalog # AAPP28686)
Printable datasheet for anti-ACAA1 (ARP48177_P050) antibody
Target Reference:
Park,H.C., (2005) Yonsei Med. J. 46 (6), 779-787
Gene Symbol:
Official Gene Full Name:
Acetyl-CoA acyltransferase 1
Alias Symbols:
NCBI Gene Id:
Protein Name:
3-ketoacyl-CoA thiolase, peroxisomal
Description of Target:
ACAA1 is an enzyme operative in the beta-oxidation system of the peroxisomes. Deficiency of this enzyme leads to pseudo-Zellweger syndrome.Acetyl-Coenzyme A acyltransferase (ACAA1) is an enzyme operative in the beta-oxidation system of the peroxisomes. Deficiency of this enzyme leads to pseudo-Zellweger syndrome. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Protein Size (# AA):
Molecular Weight:
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express ACAA1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express ACAA1.
Protein Interactions:

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...