Search Antibody, Protein, and ELISA Kit Solutions

ABCA12 Antibody - middle region (ARP43683_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP43683_P050-FITC Conjugated

ARP43683_P050-HRP Conjugated

ARP43683_P050-Biotin Conjugated

Tested Species Reactivity:
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:
Official Gene Full Name:
ATP-binding cassette, sub-family A (ABC1), member 12
NCBI Gene Id:
Protein Name:
ATP-binding cassette sub-family A member 12
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
DKFZp434G232, FLJ41584, ICR2B, LI2
Replacement Item:
This antibody may replace item sc-48435 from Santa Cruz Biotechnology.
Description of Target:
The membrane-associated protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intracellular membranes. ABC genes are divided into seven distinct s
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express ABCA12.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express ABCA12.
The immunogen is a synthetic peptide directed towards the middle region of human ABCA12
Predicted Homology Based on Immunogen Sequence:
Cow: 93%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 93%
Complete computational species homology data:
Anti-ABCA12 (ARP43683_P050)
Peptide Sequence:
Synthetic peptide located within the following region: TTIFKMLTGDIIPSSGNILIRNKTGSLGHVDSHSSLVGYCPQEDALDDLV
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-ABCA12 (ARP43683_P050) antibody is Catalog # AAP43683 (Previous Catalog # AAPP11672)
Printable datasheet for anti-ABCA12 (ARP43683_P050) antibody

Hlaváč, V. et al. The expression profile of ATP-binding cassette transporter genes in breast carcinoma. Pharmacogenomics 14, 515-29 (2013). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 23556449

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...