Size:100 ul
$319.00
In Stock
SKU
ARP43683_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP43683_P050-FITC Conjugated

ARP43683_P050-HRP Conjugated

ARP43683_P050-Biotin Conjugated

ABCA12 Antibody - middle region (ARP43683_P050)

Catalog#: ARP43683_P050
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-48435 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human ABCA12
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 93%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 93%
Complete computational species homology data Anti-ABCA12 (ARP43683_P050)
Peptide Sequence Synthetic peptide located within the following region: TTIFKMLTGDIIPSSGNILIRNKTGSLGHVDSHSSLVGYCPQEDALDDLV
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-ABCA12 (ARP43683_P050) antibody is Catalog # AAP43683 (Previous Catalog # AAPP11672)
Datasheets/Manuals Printable datasheet for anti-ABCA12 (ARP43683_P050) antibody
Publications

Hlaváč, V. et al. The expression profile of ATP-binding cassette transporter genes in breast carcinoma. Pharmacogenomics 14, 515-29 (2013). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 23556449

Gene Symbol ABCA12
Official Gene Full Name ATP-binding cassette, sub-family A (ABC1), member 12
Alias Symbols DKFZp434G232, FLJ41584, ICR2B, LI2
NCBI Gene Id 26154
Protein Name ATP-binding cassette sub-family A member 12
Description of Target The membrane-associated protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intracellular membranes. ABC genes are divided into seven distinct s
Swissprot Id Q86UK0
Protein Accession # NP_056472
Nucleotide Accession # NM_015657
Protein Size (# AA) 2277
Molecular Weight 257kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express ABCA12.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express ABCA12.
Protein Interactions UBC;
  1. What is the species homology for "ABCA12 Antibody - middle region (ARP43683_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat".

  2. How long will it take to receive "ABCA12 Antibody - middle region (ARP43683_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "ABCA12 Antibody - middle region (ARP43683_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "ABCA12 Antibody - middle region (ARP43683_P050)"?

    This target may also be called "DKFZp434G232, FLJ41584, ICR2B, LI2" in publications.

  5. What is the shipping cost for "ABCA12 Antibody - middle region (ARP43683_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "ABCA12 Antibody - middle region (ARP43683_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "ABCA12 Antibody - middle region (ARP43683_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "257kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "ABCA12 Antibody - middle region (ARP43683_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "ABCA12"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "ABCA12"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "ABCA12"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "ABCA12"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "ABCA12"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "ABCA12"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:ABCA12 Antibody - middle region (ARP43683_P050)
Your Rating