ABCA12 Antibody - middle region (ARP43683_P050)

• Product Number: ARP43683_P050
• Name: ABCA12 Antibody - middle region (ARP43683_P050)
• Protein Size (# AA): 2595 amino acids
• Molecular Weight: 293 kDa
• NCBI Gene Id: 26154
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: ATP-binding cassette, sub-family A (ABC1), member 12
• Alias Symbols: LI2, ICR2B, ARCI4A, ARCI4B
• Peptide Sequence: Synthetic peptide located within the following region: TTIFKMLTGDIIPSSGNILIRNKTGSLGHVDSHSSLVGYCPQEDALDDLV
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Description of Target: The membrane-associated protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intracellular membranes. ABC genes are divided into seven distinct s
• Protein Interactions: UBC;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Enhanced Validation: Relative Expression (Western Blot)
  
• Blocking Peptide: For anti-ABCA12 (ARP43683_P050) antibody is Catalog # AAP43683 (Previous Catalog # AAPP11672)
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ABCA12
• Uniprot ID: Q86UK0
• Protein Name: ATP-binding cassette sub-family A member 12
• Publications:

  Hlaváč, V. et al. The expression profile of ATP-binding cassette transporter genes in breast carcinoma. Pharmacogenomics 14, 515-29 (2013). 23556449

• Protein Accession #: NP_056472
• Purification: Affinity Purified
• Nucleotide Accession #: NM_015657
• Tested Species Reactivity: Human
• Gene Symbol: ABCA12
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 93%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 93%
• Image 1: Human Stomach
  
  WB Suggested Anti-ABCA12 Antibody Titration: 0.2-1 ug/ml
  Positive Control: Human Stomach
• Image 2:
  
  Surface Plasmon Resonance Kinetic Characterization of Polyclonal Antibody Affinity. Purified polyclonal antibodies were immobilized on a Protein A/G coated Carterra LSA sensor chip (PAGH200M) at concentrations of 5, and 50 ug/mL in duplicate. Antibodies on the surface were exposed to interaction with peptides sequentially via microfluidic controlled flow at 333nM peptide concentration for kinetic characterization of the binders for affinity and specificity, followed by curve fitting using the Kinetics software. Kd determinations for both concentrations were averaged and results and standard deviation are shown.