Now Offering Over 102,157 Antibodies & 44,722 Antigens!

AATK Antibody - C-terminal region (ARP73727_P050)

100 ul
$289.00
In Stock

Conjugation Options

ARP73727_P050-FITC Conjugated

ARP73727_P050-HRP Conjugated

ARP73727_P050-Biotin Conjugated

Gene Symbol:
AATK
NCBI Gene Id:
9625
Swissprot Id:
Q6ZMQ8
Alias Symbols:
AATK, AATYK, KIAA0641, LMR1, LMTK1,
Replacement Item:
This antibody may replace item sc-100436 from Santa Cruz Biotechnology.
Description of Target:
The protein encoded by this gene contains a tyrosine kinase domain at the N-terminus and a proline-rich domain at the C-terminus. This gene is induced during apoptosis, and expression of this gene may be a necessary pre-requisite for the induction of growth arrest and/or apoptosis of myeloid precursor cells. This gene has been shown to produce neuronal differentiation in a neuroblastoma cell line. Two transcript variants encoding different isoforms have been found for this gene.
Protein Size (# AA):
1374
Molecular Weight:
151kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express AATK.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express AATK.
Immunogen:
The immunogen is a synthetic peptide directed towards the C-terminal region of Human AATK
Species Reactivity:
Human
Peptide Sequence:
Synthetic peptide located within the following region: APNRPQQADGSPNGSTAEEGGGFAWDDDFPLMTAKAAFAMALDPAAPAPA
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
PPP1CC; PPP1CA; STK39;
Blocking Peptide:
For anti-AATK (ARP73727_P050) antibody is Catalog # AAP73727
Datasheets/Manuals:
Printable datasheet for anti-AATK (ARP73727_P050) antibody

Tell us what you think about this item!

Write A Review
    Please, wait...