| Product Number |
ARP73727_P050 |
| Product Page |
www.avivasysbio.com/aatk-antibody-c-terminal-region-arp73727-p050.html |
| Name |
AATK Antibody - C-terminal region (ARP73727_P050) |
| Protein Size (# AA) |
1374 amino acids |
| Molecular Weight |
151kDa |
| NCBI Gene Id |
9625 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Alias Symbols |
LMR1, AATYK, LMTK1, p35BP, AATYK1, PPP1R77 |
| Peptide Sequence |
Synthetic peptide located within the following region: APNRPQQADGSPNGSTAEEGGGFAWDDDFPLMTAKAAFAMALDPAAPAPA |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
The protein encoded by this gene contains a tyrosine kinase domain at the N-terminus and a proline-rich domain at the C-terminus. This gene is induced during apoptosis, and expression of this gene may be a necessary pre-requisite for the induction of growth arrest and/or apoptosis of myeloid precursor cells. This gene has been shown to produce neuronal differentiation in a neuroblastoma cell line. Two transcript variants encoding different isoforms have been found for this gene. |
| Protein Interactions |
PPP1CC; PPP1CA; STK39; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-AATK (ARP73727_P050) antibody |
| Blocking Peptide |
For anti-AATK (ARP73727_P050) antibody is Catalog # AAP73727 |
| Immunogen |
The immunogen is a synthetic peptide directed towards the C-terminal region of Human AATK |
| Uniprot ID |
Q6ZMQ8 |
| Purification |
Affinity Purified |
| Tested Species Reactivity |
Human |
| Gene Symbol |
AATK |
| Predicted Species Reactivity |
Human |
| Application |
WB |
| Image 1 | Human 293T Whole cell
 | Host: Rabbit
Target Name: AATK
Sample Type: 293T Whole cell lysates
Antibody Dilution: 1.0ug/ml |
|
|
