SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP33515_P050-FITC
Size:100ul
Price: $434.00
SKU
ARP33515_P050-FITC
Availability: Domestic: within 24 hours delivery | International: 3-5 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.

ZNF182 Antibody - C-terminal : FITC (ARP33515_P050-FITC)

Datasheets/ManualsPrintable datasheet for anti-ZNF182 (ARP33515_P050-FITC) antibody
Product Info
Predicted Species ReactivityHuman
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer.
ClonalityPolyclonal
HostRabbit
ConjugationFITC: Fluorescein Isothiocyanate
ApplicationWB
Reconstitution and StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
ImmunogenThe immunogen for Anti-ZNF182 antibody is: synthetic peptide directed towards the C-terminal of Human ZN182
PurificationAffinity purified
Peptide SequenceSynthetic peptide located within the following region: NECKKTFSDKSTLIIHQRTHTGEKPHKCTECGKSFNEKSTLIVHQRTHTG
Concentration0.5 mg/ml
Blocking PeptideFor Anti-ZNF182 antibody is Catalog # AAP33515
Gene SymbolZNF182
Gene Full Namezinc finger protein 182
Alias SymbolsKOX14, ZNF21, HHZ150, Zfp182
NCBI Gene Id7569
Description of TargetZinc-finger proteins bind nucleic acids and play important roles in various cellular functions, including cell proliferation, differentiation, and apoptosis. This gene encodes a zinc finger protein, and belongs to the krueppel C2H2-type zinc-finger protein family. It may be involved in transcriptional regulation. Multiple alternatively spliced transcript variants encoding different isoforms have been identified.
Uniprot IDP17025
Protein Accession #NP_008893.1
Protein Size (# AA)639
Molecular Weight70 kDa
  1. What is the species homology for "ZNF182 Antibody - C-terminal : FITC (ARP33515_P050-FITC)"?

    The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human".

  2. How long will it take to receive "ZNF182 Antibody - C-terminal : FITC (ARP33515_P050-FITC)"?

    This item is available "Domestic: within 24 hours delivery | International: 3-5 days".

  3. What buffer format is "ZNF182 Antibody - C-terminal : FITC (ARP33515_P050-FITC)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "ZNF182 Antibody - C-terminal : FITC (ARP33515_P050-FITC)"?

    This target may also be called "KOX14, ZNF21, HHZ150, Zfp182" in publications.

  5. What is the shipping cost for "ZNF182 Antibody - C-terminal : FITC (ARP33515_P050-FITC)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "ZNF182 Antibody - C-terminal : FITC (ARP33515_P050-FITC)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "ZNF182 Antibody - C-terminal : FITC (ARP33515_P050-FITC)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "70 kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "ZNF182 Antibody - C-terminal : FITC (ARP33515_P050-FITC)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "ZNF182"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "ZNF182"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "ZNF182"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "ZNF182"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "ZNF182"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "ZNF182"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:ZNF182 Antibody - C-terminal : FITC (ARP33515_P050-FITC)
Your Rating
We found other products you might like!