YWHAE Antibody - C-terminal region (ARP90117_P050)

Catalog No: ARP90117_P050

Host: Rabbit
Target Name: YWHAE
Sample Tissue: Mouse Brain lysates
Antibody Dilution: 1ug/ml

Product Info

• Tested Species Reactivity: Mouse
• Predicted Species Reactivity: Mouse
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -27C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of mouse YWHAE
• Purification: Affinity purified
• Peptide Sequence: Synthetic peptide located within the following region: AFDDAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDMQGDGEEQNKEAL
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-YWHAE (ARP90117_P050) antibody is Catalog # AAP90117

Target Info

• Gene Symbol: YWHAE
• Gene Full Name: tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, epsilon polypeptide
• Alias Symbols: AU019196
• NCBI Gene Id: 22627
• Protein Name: 14-3-3 protein epsilon
• Description of Target: Adapter protein implicated in the regulation of a large spectrum of both general and specialized signaling pathways. Binds to a large number of partners, usually by recognition of a phosphoserine or phosphothreonine motif. Binding generally results in the modulation of the activity of the binding partner. Positively regulates phosphorylated protein HSF1 nuclear export to the cytoplasm.
• Uniprot ID: P62259
• Protein Accession #: NP_033562.3
• Nucleotide Accession #: NM_009536.4
• Protein Size (# AA): 255
• Molecular Weight: 29 kDa