XRN2 Antibody (OAAF07913)

Catalog No: OAAF07913 (Formerly GWB-ASD870)

Size:100 ug

Western blot analysis of lysates from COS7 cells, using XRN2 Antibody. The lane on the right is blocked with the synthesized peptide.

Immunohistochemistry analysis of paraffin-embedded human breast carcinoma tissue, using XRN2 Antibody. The picture on the right is blocked with the synthesized peptide.

Product Info

• Predicted Species Reactivity: Human|Monkey|Mouse
• Clonality: Polyclonal
• Host: Rabbit
• Application: Enzyme-linked immunosorbent assay|Immunofluorescence|Immunohistochemistry|Immunohistochemistry-Paraffin|Western blot
• Reconstitution and Storage: -20°C
• Immunogen: The antiserum was produced against synthesized peptide derived from human XRN2.
• Purification: The antibody was purified from rabbit antiserum by affinity-chromatography using immunogen.
• Peptide Sequence: Synthetic peptide located within the following region: IFEYIDRLFSIVRPRRLLYMAIDGVAPRAKMNQQRSRRFRASKEGMEAAV
• Concentration: 1mg/ml
• Specificity: XRN2 Antibody detects endogenous levels of total XRN2 protein.
• Formulation: Rabbit IgG in phosphate buffered saline (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol.
• Application Info: WB: 1:500~1:1000
  IHC: 1:50~1:100
  ELISA: 1:1000

Target Info

• Gene Symbol: XRN2
• Gene Full Name: 5'-3' exoribonuclease 2
• Alias Symbols: 5'-3' exoribonuclease 2;DHM1-like protein;DHP protein.
• NCBI Gene Id: 22803
• Protein Name: 5'-3' exoribonuclease 2
• Description of Target: Possesses 5'->3' exoribonuclease activity (By similarity). May promote the termination of transcription by RNA polymerase II. During transcription termination, cleavage at the polyadenylation site liberates a 5' fragment which is subsequently processed to form the mature mRNA and a 3' fragment which remains attached to the elongating polymerase. The processive degradation of this 3' fragment by this protein may promote termination of transcription. Binds to RNA polymerase II (RNAp II) transcription termination R-loops formed by G-rich pause sites (PubMed:21700224).
• Uniprot ID: Q9H0D6
• Molecular Weight: 108 kDa