- Toll Free: 888-880-0001
- Phone: 858-552-6979
- Email: info@avivasysbio.com
- $55: Antibody & Protein in US
- $55 + $25/Kit in US
- Contact us for international orders.
Datasheets/Manuals | Printable datasheet for XRN2 Antibody (OAAF07913) |
---|
Predicted Species Reactivity | Human|Monkey|Mouse |
---|---|
Clonality | Polyclonal |
Host | Rabbit |
Application | Enzyme-linked immunosorbent assay|Immunofluorescence|Immunohistochemistry|Immunohistochemistry-Paraffin|Western blot |
Reconstitution and Storage | -20°C |
Immunogen | The antiserum was produced against synthesized peptide derived from human XRN2. |
Purification | The antibody was purified from rabbit antiserum by affinity-chromatography using immunogen. |
Peptide Sequence | Synthetic peptide located within the following region: IFEYIDRLFSIVRPRRLLYMAIDGVAPRAKMNQQRSRRFRASKEGMEAAV |
Concentration | 1mg/ml |
Specificity | XRN2 Antibody detects endogenous levels of total XRN2 protein. |
Formulation | Rabbit IgG in phosphate buffered saline (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. |
Application Info | WB: 1:500~1:1000 IHC: 1:50~1:100 ELISA: 1:1000 |
Gene Symbol | XRN2 |
---|---|
Gene Full Name | 5'-3' exoribonuclease 2 |
Alias Symbols | 5'-3' exoribonuclease 2;DHM1-like protein;DHP protein. |
NCBI Gene Id | 22803 |
Protein Name | 5'-3' exoribonuclease 2 |
Description of Target | Possesses 5'->3' exoribonuclease activity (By similarity). May promote the termination of transcription by RNA polymerase II. During transcription termination, cleavage at the polyadenylation site liberates a 5' fragment which is subsequently processed to form the mature mRNA and a 3' fragment which remains attached to the elongating polymerase. The processive degradation of this 3' fragment by this protein may promote termination of transcription. Binds to RNA polymerase II (RNAp II) transcription termination R-loops formed by G-rich pause sites (PubMed:21700224). |
Uniprot ID | Q9H0D6 |
Molecular Weight | 108 kDa |
- Protocol:
- Reconstitution & Storage Instructions
- Western Blotting/Immunoblotting (WB/IB) Protocol
- Immunohistochemistry (IHC) Protocol
- Immunocytochemistry (ICC) Protocol
- Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
- Blocking Peptide Competition Protocol (BPCP)
- Immunoprecipitation (IP) Protocol
- Antibody Array (AA) Protocol
- Tips Information:
-
See our General FAQ page.
-
What is the species homology for "XRN2 Antibody (OAAF07913)"?
The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human|Monkey|Mouse".
-
How long will it take to receive "XRN2 Antibody (OAAF07913)"?
This item is available "Domestic: within 1-2 week delivery | International: 1-2 weeks".
-
What buffer format is "XRN2 Antibody (OAAF07913)" provided in?
This item is provided in "".
Additional format options may be available. For more information please contact info@avivasysbio.com. -
What are other names for "XRN2 Antibody (OAAF07913)"?
This target may also be called "5'-3' exoribonuclease 2;DHM1-like protein;DHP protein." in publications.
-
What is the shipping cost for "XRN2 Antibody (OAAF07913)"?
The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.
-
What is the guarantee for "XRN2 Antibody (OAAF07913)"?
All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.
-
Can I get bulk pricing for "XRN2 Antibody (OAAF07913)"?
You can get bulk pricing for this item by going here.
-
What is the molecular weight of the protein?
The molecular weight reported by Uniprot for this item is "108 kDa".
Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics. -
What protocols are available for "XRN2 Antibody (OAAF07913)"?
We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.
-
What are positive controls for "XRN2"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What are negative controls for "XRN2"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What other proteins interact with "XRN2"?
This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.
-
What biological processes are associated with "XRN2"?
This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.
-
What cellular components are associated with "XRN2"?
This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.
-
What protein functions are associated with "XRN2"?
This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.