WWOX Antibody - middle region (ARP89583_P050)

Catalog No: ARP89583_P050

Host: Rabbit
Target Name: WWOX
Sample Tissue: Mouse Lung lysates
Antibody Dilution: 1ug/ml

Product Info

• Tested Species Reactivity: Mouse
• Predicted Species Reactivity: Mouse
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of mouse WWOX
• Purification: Affinity purified
• Peptide Sequence: Synthetic peptide located within the following region: ETDENGQVFFVDHINKRTTYLDPRLAFTVDDNPTKPTTRQRYDGSTTAME
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-WWOX (ARP89583_P050) antibody is Catalog # AAP89583

Target Info

• Gene Symbol: WWOX
• Gene Full Name: WW domain-containing oxidoreductase
• Alias Symbols: WOX, WOX1, 5330426P09Rik, 9030416C10Rik
• NCBI Gene Id: 80707
• Protein Name: WW domain-containing oxidoreductase
• Description of Target: Putative oxidoreductase. Acts as a tumor suppressor and plays a role in apoptosis. May function synergistically with p53/TP53 to control genotoxic stress-induced cell death. Plays a role in TGFB1 signaling and TGFB1-mediated cell death. Inhibits Wnt signaling, probably by sequestering DVL2 in the cytoplasm (By similarity). May also play a role in tumor necrosis factor (TNF)-mediated cell death. Required for normal bone development.
• Uniprot ID: Q91WL8
• Protein Accession #: NP_062519.2
• Nucleotide Accession #: NM_019573.3
• Protein Size (# AA): 414
• Molecular Weight: 45 kDa